(data stored in ACNUC13479 zone)

EMBL: CP002688.PE192

CP002688.PE192       Location/Qualifiers
FT   CDS_pept        complement(join(373014..373319,373401..373568,
FT                   373660..373863,373942..374067,374166..374270,
FT                   374505..374651))
FT                   /codon_start=1
FT                   /gene_synonym="T7H20.20"
FT                   /gene_synonym="T7H20_20"
FT                   /locus_tag="AT5G01970"
FT                   /product="heat-inducible transcription repressor"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT1G30050.1); Has 240 Blast
FT                   hits to 236 proteins in 72 species: Archae - 0; Bacteria -
FT                   15; Metazoa - 51; Fungi - 19; Plants - 119; Viruses - 0;
FT                   Other Eukaryotes - 36 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01970"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZN4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES148234.1,INSD:ES088521.1,INSD:DR364977.1,
FT                   INSD:BP602982.1,INSD:AV813758.1,INSD:BP852438.1,
FT                   INSD:DR376177.1,INSD:EL993490.1,INSD:EH885634.1,
FT                   INSD:BP617848.1,INSD:EL261050.1,INSD:BP610341.1,
FT                   INSD:BP854911.1,INSD:BP633168.1,INSD:AV440114.1,
FT                   INSD:ES216087.1,INSD:ES060403.1,INSD:ES199462.1,
FT                   INSD:AA651156.1,INSD:BP671641.1,INSD:EH862623.1,
FT                   INSD:AV830045.1,INSD:BP854344.1,INSD:AV809752.1,
FT                   INSD:AV535704.1,INSD:BP619694.1,INSD:BP808597.1,
FT                   INSD:EL052097.1,INSD:ES048200.1,INSD:DR384098.1,
FT                   INSD:EG463064.1,INSD:EL031229.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832073.1,INSD:AY072408.1,INSD:BT000237.1"
FT                   /protein_id="AED90415.1"
FT                   /translation="MAYRRRQGIGKFATFKEEVDRLPPESITAVKDRSPPARSSPAFDQ
FT                   PRSKNFTTEPKGLWGVIAQKAKSVIEDDKSSDRSTTASQSRFSYLSDEGFKKMDNPKLR
FT                   RGLDKLTSSLNQIGDTFEKAFEDGRTLVENKTADIIQETRKLQTRRRGTGGEDENQNQS
FT                   YGVSSSWKKSPEQPMQLNHIEHETQLKASRDVAMATAAKAKLLLRELKTVKADLAFAKE
FT                   RCAQLEEENKHLRESHREKGSNPADEDLIRLQLESLLAEKARLAHENSVYARENRFLRE
FT                   IVEYHQLTMQDVVYIDEGSEEVTQVSPFVSTLMTSSPADRSQSPPSQEMIKEMLVVAEE
FT                   SSVCASVVSVS"
     atggcgtata gaagaaggca ggggatcgga aagtttgcga ctttcaagga ggaggttgat        60
     cggcttcccc cggaaagcat caccgccgtc aaggatagat caccgccagc tcgatcctcc       120
     cctgcttttg accaacccag atctaagaat tttacgaccg agccaaaggg cttgtgggga       180
     gtcatagccc agaaagcaaa atctgttatt gaagatgata aatctagtga tcgctctaca       240
     acagcttctc agtcccggtt ttcataccta tcagatgaag ggttcaagaa aatggacaat       300
     cccaagcttc ggagggggct ggataagctt acatcttctc ttaatcagat cggtgacact       360
     tttgaaaaag cctttgagga tggccgaaca ctcgttgaga acaaaacagc tgatatcatc       420
     caggaaacac gaaaacttca aaccagacga agaggaactg gtggtgaaga tgagaatcag       480
     aatcaatctt atggagttag tagctcatgg aagaagtctc cagagcagcc aatgcagtta       540
     aatcatatag aacatgaaac tcaactcaag gcatctcgcg atgtggcgat ggccactgct       600
     gctaaagcta aactactcct ccgtgagctg aaaactgtca aagcagatct tgcatttgcg       660
     aaagagcgtt gtgctcagct tgaggaagag aacaaacatc tgagagagag ccaccgtgag       720
     aaaggaagca accctgcaga cgaagatttg attcgactcc agctggagag cctactggca       780
     gagaaagcac ggttggctca tgaaaattct gtgtatgcga gggaaaaccg gttcttgagg       840
     gagatagttg aataccacca gcttacgatg caggacgttg tgtacataga cgagggcagt       900
     gaagaggtga cacaagtttc ccctttcgta tcgacgttga tgacttcttc acccgctgac       960
     cgttcacagt ctcctcctag tcaagagatg attaaagaga tgcttgtggt tgctgaagag      1020
     agctctgtgt gtgcaagtgt ggtttcagtt tcttga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page