(data stored in ACNUC13479 zone)

EMBL: CP002688.PE194

CP002688.PE194       Location/Qualifiers
FT   CDS_pept        375542..377023
FT                   /codon_start=1
FT                   /gene_synonym="T7H20.30"
FT                   /gene_synonym="T7H20_30"
FT                   /locus_tag="AT5G01980"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc
FT                   ion binding; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Zinc
FT                   finger, RING-type (InterPro:IPR001841), Zinc finger, C3HC4
FT                   RING-type (InterPro:IPR018957); BEST Arabidopsis thaliana
FT                   protein match is: RING/U-box superfamily protein
FT                   (TAIR:AT5G08139.1); Has 7827 Blast hits to 7813 proteins in
FT                   270 species: Archae - 0; Bacteria - 9; Metazoa - 2445;
FT                   Fungi - 565; Plants - 3731; Viruses - 72; Other Eukaryotes
FT                   - 1005 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZN3"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZN3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR260584.1,INSD:AV441319.1,INSD:AV551469.1,
FT                   INSD:DR260581.1,INSD:EL277240.1,INSD:BG459143.1,
FT                   INSD:EH878080.1,INSD:EH984701.1,INSD:DR380969.1,
FT                   INSD:ES010506.1,INSD:DR260579.1,INSD:DR260585.1,
FT                   INSD:AV562413.1,INSD:ES024013.1,INSD:CA781575.1,
FT                   INSD:EH959271.1,INSD:DR260582.1,INSD:EH802410.1,
FT                   INSD:DR260580.1,INSD:EH991196.1,INSD:BP807909.1,
FT                   INSD:ES021913.1,INSD:BP850946.1,INSD:EH826893.1,
FT                   INSD:EH877176.1,INSD:DR260583.1,INSD:EL264037.1,
FT                   INSD:EL985971.1,INSD:AV539111.1,INSD:AV442150.1,
FT                   INSD:DR242098.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK230335.1,INSD:BX832272.1,INSD:BT029027.1,
FT                   INSD:BX831675.1,INSD:AK176418.1,INSD:BT021990.1,
FT                   INSD:BX832364.1"
FT                   /protein_id="AED90416.1"
FT                   /translation="MESQGPSNGHPMDISSNSIPSSACNLCGRVVQSASDDLEIFSLCV
FT                   DCKFLLLEDFGTPAPPLARRQTIRRRRMRRRRRTTRHDSSESVGVGDLSSQQFTHLISI
FT                   ARQSLSTVQASEDLRDDLRTSSHTTPSGSTRWRLFSESESDDFDNFGETESNASFSLYR
FT                   FPHADNDTISFSAYGGESDASTDRHADIFVQPDDRSDIDFDTDIDPMRAGLNQWNSDEE
FT                   DREWEEGAGPSGVAGTRYRNYLASPSESYSSMTRFDSPELERSFRQRIIERRHSLSRNI
FT                   FTGLEDLDFSPYAANVGDYLDERGFDELLEQLAESDNSRRGAPPASVSCVRNLPRVIIA
FT                   EEHVMKGLVCAICKELFSLRNETTQLPCLHLYHAHCIVPWLSARNSCPLCRYELPTDDK
FT                   DYEEGKRNVLDVSEDSSSSDDGTESGEEEYVERGESESGVSRVSRGRWLFLAAAPVVSL
FT                   VGVVLAMWLSSPHRRGIAISHSQRENRTRRWLPFF"
     atggaatcac aaggaccttc taatggtcat cccatggata tcagcagcaa ttcaatccca        60
     tcgtctgcct gtaatctgtg cggaagagtc gttcaatctg cttccgatga tcttgaaatc       120
     ttcagcttat gtgtcgactg taagtttttg ttgcttgaag atttcggcac tcccgcgcct       180
     cccttggctc ggcggcagac aattaggagg aggaggatga ggaggaggag aagaacaact       240
     aggcacgaca gctctgagtc tgtcggtgtc ggtgatcttt cctcccaaca attcacacac       300
     ttgataagca ttgcaagaca aagcctttca acggttcaag ctagtgagga tctacgtgat       360
     gacctgcgaa ctagctccca taccactcca agcggctcga caagatggag actcttctca       420
     gaatctgaaa gtgatgattt tgacaacttt ggcgaaaccg aatcaaacgc tagctttagc       480
     ctctacagat ttccccatgc tgataacgat accatttctt ttagtgctta cggtggagag       540
     tctgatgctt ccacggacag gcatgccgat atctttgttc aaccagatga caggagcgac       600
     attgactttg acactgatat agacccgatg cgcgctggtc ttaaccagtg gaactcagac       660
     gaagaagaca gggaatggga ggaaggagcg ggtccttctg gggttgcagg aacacgctat       720
     agaaactatt tggcaagtcc aagtgagagc tacagctcca tgactcggtt tgattcacct       780
     gagttagaga gaagctttcg tcaaagaatt atagagagga ggcattcgtt atctcgcaac       840
     atcttcactg gtttggagga tttggacttc tccccctatg ctgcaaatgt tggggattat       900
     cttgatgaga gaggctttga tgaactgctt gagcaacttg ctgagtctga caattcaaga       960
     agaggtgcac cacctgcatc tgtctcatgc gtcaggaatc ttccaagggt tatcattgca      1020
     gaggagcatg taatgaaggg cctagtttgt gcgatctgca aggagctttt ctccctccgc      1080
     aatgaaacca cgcagcttcc gtgtctacat ctataccatg ctcattgtat cgtaccttgg      1140
     ctgagtgccc gtaactcctg cccactctgc cgttatgagc tcccgacaga tgataaagat      1200
     tacgaggagg gaaagcggaa tgtgctggat gtgagcgagg atagctcctc ctctgatgat      1260
     ggtacagaat cgggggaaga ggaatatgta gagagaggtg agagcgagtc tggtgtgagc      1320
     agagtcagca gaggaagatg gctgtttctg gctgctgcac cagttgtgag tctggtgggc      1380
     gttgtgttgg caatgtggct aagcagccca cacaggaggg gtatagcaat ctctcatagc      1440
     caaagggaga acagaaccag aagatggctg ccgtttttct ga                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page