(data stored in ACNUC13479 zone)

EMBL: CP002688.PE195

CP002688.PE195       Location/Qualifiers
FT   CDS_pept        complement(join(377373..377683,377775..377827,
FT                   377907..378007,378121..378195,378298..378528,
FT                   378830..378951,379029..379153,379232..379311,
FT                   379403..379600))
FT                   /codon_start=1
FT                   /gene_synonym="T7H20.40"
FT                   /gene_synonym="T7H20_40"
FT                   /gene_synonym="PILS6"
FT                   /gene_synonym="PIN-LIKES 6"
FT                   /locus_tag="AT5G01990"
FT                   /product="Auxin efflux carrier family protein"
FT                   /note="Auxin efflux carrier family protein; FUNCTIONS IN:
FT                   auxin:hydrogen symporter activity; INVOLVED IN: auxin polar
FT                   transport, transmembrane transport; LOCATED IN: integral to
FT                   membrane; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Auxin
FT                   efflux carrier (InterPro:IPR004776); BEST Arabidopsis
FT                   thaliana protein match is: Auxin efflux carrier family
FT                   protein (TAIR:AT1G71090.1); Has 514 Blast hits to 486
FT                   proteins in 113 species: Archae - 2; Bacteria - 6; Metazoa
FT                   - 0; Fungi - 225; Plants - 217; Viruses - 0; Other
FT                   Eukaryotes - 64 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZN2"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR039305"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZN2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL283049.1,INSD:ES072120.1,INSD:ES036133.1,
FT                   INSD:BP846668.1,INSD:BP588778.1,INSD:EL024781.1,
FT                   INSD:AU036570.1,INSD:ES021913.1,INSD:AU231077.1,
FT                   INSD:EH868614.1,INSD:ES135887.1,INSD:AU236480.1,
FT                   INSD:AU227410.1,INSD:BP842377.1,INSD:EL997047.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832768.1,INSD:BX832718.1,INSD:BT002925.1,
FT                   INSD:BX829574.1,INSD:BX829737.1"
FT                   /protein_id="AED90417.1"
FT                   /translation="MIARILAALADSMEMPVAAGGGSVLGTIKIAVMPIAKVFTMCFLG
FT                   LLMASKYVNILPPSGRKLLNGLVFSLLLPCLIFSQLGQAVTLQKMLQWWFIPVNVVLGT
FT                   ISGSIIGFIVASIVRPPYPYFKFTIIQIGVGNIGNVPLVLLAALCRDTSNPFGDSEKCS
FT                   IDGTAYISFGQWVGAIILYTYVYQMFAPPPEGFDAEEENLALKTLPVDAAPEQVPLLTQ
FT                   NFPKDFSPTQDLLPVQSTEPRGRGVSRKGKIAQIFVFLYEKLKLKQIVQPAIVASILAM
FT                   ILGAIPFTKKLIFTNGAPLFFFTDSCMILGDAMIPCILLALGGNLINGPGSSKLGFKTT
FT                   AAIIIGRLVLVPPVGLGIVTVADKLGFLPADDKMFRFVLLLQHTMPTSVLSGAVANLRG
FT                   CGRESAAVLFWVHIFAIFSMAGWMVLYINILF"
     atgattgctc ggatccttgc cgccttagcc gattccatgg agatgccggt ggctgccggt        60
     ggtggatcag tgctcggtac catcaaaatc gctgtgatgc caattgcaaa ggtattcacc       120
     atgtgcttct tgggtcttct catggcctcc aagtacgtta acatcttgcc tccctctggc       180
     cgcaaactct tgaacgggtt ggtcttctcg cttttgcttc cctgcttgat cttttcccag       240
     ctcggacaag ccgtcactct ccaaaaaatg cttcagtggt ggttcattcc cgttaacgtc       300
     gttcttggca ccatctctgg ctccataatc ggtttcatcg ttgcttccat cgttcgtccg       360
     ccttaccctt acttcaagtt tacaatcata caaattggag ttggcaacat tggcaatgtg       420
     cctcttgttt tacttgcggc tctttgtagg gacacttcca acccttttgg tgactccgaa       480
     aaatgtagca ttgatggcac tgcttatatc tcctttggtc aatgggttgg tgccatcatc       540
     ctctatacat atgtgtacca gatgtttgct cctcctccag aagggtttga tgctgaagaa       600
     gaaaatcttg ctttaaaaac ccttccagta gatgctgctc cagagcaagt ccccttgctt       660
     actcagaatt ttcccaagga cttttcgccg actcaagatc ttttgcctgt acagagcacc       720
     gaacctaggg gaagaggggt ttcaaggaaa ggcaagattg cacagatctt tgttttcctc       780
     tatgagaagc tgaaactgaa gcaaattgtc cagcctgcaa ttgttgcttc gatccttgcc       840
     atgatactcg gagcaatacc tttcacaaag aagttgatat tcacaaatgg tgcacctcta       900
     ttcttcttca cagacagctg catgattctt ggggacgcga tgataccgtg tatcttactg       960
     gcactggggg gaaatctcat taacggacca ggaagttcaa aacttggttt caagacaaca      1020
     gcagctatta taattggacg gttggtgtta gtgccaccag taggactagg aatcgtgaca      1080
     gtagcagaca aacttgggtt ccttcctgct gatgataaga tgttccgatt tgtgttactc      1140
     cttcagcaca caatgcctac atcagtgctc tcaggagctg ttgccaacct tagaggctgt      1200
     ggaagggaat cagctgctgt gctcttctgg gtccacattt tcgccatctt ctcaatggct      1260
     ggatggatgg tactctacat taacatactc ttctga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page