(data stored in ACNUC13479 zone)

EMBL: CP002688.PE196

CP002688.PE196       Location/Qualifiers
FT   CDS_pept        complement(380155..380595)
FT                   /codon_start=1
FT                   /gene_synonym="T7H20.50"
FT                   /gene_synonym="T7H20_50"
FT                   /locus_tag="AT5G02000"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; Has 5 Blast hits to 5 proteins in 2
FT                   species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
FT                   Plants - 5; Viruses - 0; Other Eukaryotes - 0 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q9LZN1"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZN1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG485119.1,INSD:EG484864.1,INSD:EG485030.1,
FT                   INSD:EG484964.1,INSD:EG484820.1,INSD:EG486656.1,
FT                   INSD:EG485042.1,INSD:EG486657.1,INSD:EG484975.1,
FT                   INSD:EG485097.1,INSD:EG486658.1,INSD:EG484875.1,
FT                   INSD:EG486659.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ132718.1"
FT                   /protein_id="AED90418.1"
FT                   /translation="MENEVGWMNEASKDSSNNGESFIEIQINKAVRTTGLSISSSPSPE
FT                   NEMQTTTAIFSSATSCFSAYSSVTRLMMKVGCLSIVGVIREKVNVGERWVLQVIQRRRN
FT                   KSPLRYYYEGSMSNNKDEALTDDSLKAAIAYCNASSLSPLQT"
     atggagaacg aggtgggatg gatgaatgaa gcgtcgaagg atagcagcaa caatggtgaa        60
     tctttcattg aaatacaaat caacaaagca gtcagaacca caggattgag catctcttct       120
     tcgccatctc ccgagaacga aatgcagacg acgacagcaa tcttctcatc ggccactagt       180
     tgcttctcag catacagcag cgtgacgagg ttgatgatga aagtggggtg tttgagtata       240
     gtgggagtca taagagagaa agtaaacgtg ggagagaggt gggtcctcca agttatacag       300
     agacgacgaa acaagagccc cctacgatac tactacgaag gcagcatgag taataataag       360
     gatgaagcat taacggacga ttccctcaag gcagctatcg cttactgcaa tgcctcatct       420
     ctctcccctc tacaaacttg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page