(data stored in ACNUC13479 zone)

EMBL: CP002688.PE2

CP002688.PE2         Location/Qualifiers
FT   CDS_pept        complement(join(1388..1459,1572..1646,1745..1780,
FT                   1914..1961,2435..2509,2748..2799,2872..2934,3303..3383,
FT                   3543..3659,3762..3802,3927..4005,4102..4258,4335..4467,
FT                   4552..4679,4765..4924))
FT                   /codon_start=1
FT                   /gene_synonym="TOPTELOMERE.1"
FT                   /gene_synonym="TOPTELOMERE_1"
FT                   /locus_tag="AT5G01010"
FT                   /product="retinal-binding protein"
FT                   /note="CONTAINS InterPro DOMAIN/s: GOLD
FT                   (InterPro:IPR009038); Has 172 Blast hits to 172 proteins in
FT                   43 species: Archae - 0; Bacteria - 0; Metazoa - 95; Fungi -
FT                   0; Plants - 63; Viruses - 0; Other Eukaryotes - 14 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01010"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GSG8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR187260.1,INSD:BP826070.1,INSD:BP651478.1,
FT                   INSD:ES212707.1,INSD:BP646711.1,INSD:AA650929.1,
FT                   INSD:DR187262.1,INSD:Z37634.1,INSD:BP647136.1,
FT                   INSD:BP644726.1,INSD:BP651250.1,INSD:BP815799.1,
FT                   INSD:BP847683.1,INSD:DR187269.1,INSD:ES124603.1,
FT                   INSD:BP568621.1,INSD:AV519354.1,INSD:BP825768.1,
FT                   INSD:BP812360.2,INSD:BP584701.1,INSD:AA395636.1,
FT                   INSD:BP589164.1,INSD:BP846130.1,INSD:BP617571.1,
FT                   INSD:EH866827.1,INSD:BP835033.1,INSD:ES206247.1,
FT                   INSD:BP821517.1,INSD:BP636036.1,INSD:DR187265.1,
FT                   INSD:EL123288.1,INSD:BP669855.1,INSD:BP575092.1,
FT                   INSD:BP580018.1,INSD:DR187259.1,INSD:ES056933.1,
FT                   INSD:BP796965.1,INSD:BP584957.1,INSD:BP647818.1,
FT                   INSD:BP827398.1,INSD:EL033065.1,INSD:BP596440.1,
FT                   INSD:DR187268.1,INSD:BP655610.1,INSD:BP593388.1,
FT                   INSD:DR187271.1,INSD:BP826832.1,INSD:BP579382.1,
FT                   INSD:EL093261.1,INSD:EH912904.1,INSD:BP570833.1,
FT                   INSD:CF773050.1,INSD:EL995855.1,INSD:ES113294.1,
FT                   INSD:BP800752.1,INSD:BP867737.1,INSD:ES214429.1,
FT                   INSD:AU230908.1,INSD:DR187275.1,INSD:EH965517.1,
FT                   INSD:EL220721.1,INSD:AU230514.1,INSD:EL219028.1,
FT                   INSD:BP575248.1,INSD:EG492058.1,INSD:DR187266.1,
FT                   INSD:BP814352.2,INSD:BP660278.1,INSD:DR187267.1,
FT                   INSD:DR187273.1,INSD:BU635629.1,INSD:BP823082.1,
FT                   INSD:BP828812.1,INSD:ES181058.1,INSD:EH956632.1,
FT                   INSD:DR187272.1,INSD:ES052436.1,INSD:AU239579.1,
FT                   INSD:BP812340.1,INSD:EL321475.1,INSD:DR376054.1,
FT                   INSD:BP576423.1,INSD:T21323.1,INSD:BP570885.1,
FT                   INSD:BP639794.1,INSD:ES065956.1,INSD:BP841170.1,
FT                   INSD:BP800313.1,INSD:BP823070.1,INSD:EL166424.1,
FT                   INSD:EL291281.1,INSD:BP567984.1,INSD:EL184120.1,
FT                   INSD:BP581973.1,INSD:BP597853.1,INSD:DR187270.1,
FT                   INSD:BP836409.1,INSD:DR378517.1,INSD:BP828424.1,
FT                   INSD:BP818936.1,INSD:ES029939.1,INSD:AV783961.1,
FT                   INSD:BP627961.1,INSD:BP815149.1,INSD:BP653553.1,
FT                   INSD:BP616535.1,INSD:ES081715.1,INSD:EL088227.1,
FT                   INSD:DR211921.1,INSD:BP581797.1,INSD:ES009815.1,
FT                   INSD:AV810411.1,INSD:BP568863.1,INSD:EH937758.1,
FT                   INSD:BP596113.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK175954.1,INSD:AK175870.1,INSD:AK176023.1,
FT                   INSD:AK175670.1,INSD:AK176242.1,INSD:AK175634.1,
FT                   INSD:AK175582.1,INSD:AK175776.1,INSD:AK175802.1,
FT                   INSD:BX841661.1,INSD:AK175790.1,INSD:AK176336.1,
FT                   INSD:AK118711.1,INSD:AK176647.1,INSD:AK175920.1,
FT                   INSD:AK176058.1,INSD:AK176164.1,INSD:AK175953.1,
FT                   INSD:AK175380.1,INSD:AK176250.1,INSD:AK176507.1,
FT                   INSD:AK118368.1,INSD:AK176004.1,INSD:AK176009.1,
FT                   INSD:BX830051.1,INSD:AK175538.1,INSD:AK176260.1,
FT                   INSD:AK176032.1,INSD:AK176045.1,INSD:AK175763.1"
FT                   /protein_id="AED90282.1"
FT                   /translation="MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLL
FT                   TVQSPPSQGETSLIDEANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSE
FT                   DAEFASILRTLKDSFDNAFTAMISFQTKNSERIFSTVMTYMPQDFRGTLIRQQKERSER
FT                   NKQAEVDALVSSGGSIRDTYALLWKQQMERRRQLAQLGSATGVYKTLVKYLVGVPQVLL
FT                   DFIRQINDDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWERYDTFKLSKDQMNLLS
FT                   EAAIVYTSEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISL
FT                   MVESENSYIAWDFSLMQGKISMDIGFSVEYINASGEKTLILPYRRYEADQGNFSTLMAG
FT                   NYKLVWDNSYSTFFKKTLRYKVDCIAPVVEPDPEPEPLN"
     atggcgtcaa cggaaggcct tatgcctatc acccgggctt ttctcgcttc ttactacgac        60
     aaatatcctt tctctcctct ttccgacgac gtttctcggc tttcctctga catggcatct       120
     ctgattaagc tattgaccgt ccaatctccc ccttcacaag gggaaacttc cctgattgac       180
     gaagcaaacc gtcagccccc tcacaaaatt gatgagaata tgtggaaaaa tagggagcag       240
     atggaggaga tactgtttct tctgtcacca tctcgctggc ctgttcagct tcgggaacct       300
     tccacatccg aagatgctga attcgcttct attttgcgga ctctcaagga cagttttgat       360
     aacgcattca ctgctatgat ttccttccag acgaagaatt ccgagcgcat attcagcaca       420
     gtaatgacct acatgcctca agatttccgg ggaacgctca tcagacagca gaaggagagg       480
     tcggagagga acaaacaggc ggaggttgat gcgttggtca gctctggagg gagcatacgc       540
     gacacatatg ctcttctttg gaagcagcaa atggagagga ggaggcagtt ggctcagcta       600
     ggctctgcca ctggtgtcta caaaaccctg gtcaagtact tggtaggggt tccacaggtg       660
     ttgttggatt ttattcgaca aataaacgat gatgatgggc caatggaaga acagcgagaa       720
     cgttatggac cccctctata cagtctcaca aaaatggtga tcgcaattcg ggttttccta       780
     acacttctgt gggaaagata tgataccttc aaactgagta aagaccaaat gaatctcctg       840
     tctgaagctg ctatagtcta cacttctgag tttgaaagat tcgtcacatt tatcagcgat       900
     gtattcgcca attccccctt ctttatttca gctgatacag ctggcatatt gtggtcaagg       960
     gacaatgagg agtacaagga gataatcgtt caagctggga gaacctatga gatctcattg      1020
     atggtggaat ctgaaaattc gtatattgct tgggatttct ctttgatgca aggcaagata      1080
     agcatggata tcggatttag cgtggagtac ataaatgctt caggggaaaa gactctgata      1140
     ttaccttacc gtcggtatga agctgaccag ggcaacttct ctacgctaat ggctggaaac      1200
     tacaaacttg tttgggataa ttcatattca actttcttca aaaagactct tcgatataag      1260
     gtggattgca tagcaccagt agtggagccg gatccagagc cggagccgtt aaactga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page