(data stored in ACNUC13479 zone)

EMBL: CP002688.PE20

CP002688.PE20        Location/Qualifiers
FT   CDS_pept        complement(28532..29086)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.60"
FT                   /gene_synonym="F7J8_60"
FT                   /locus_tag="AT5G01080"
FT                   /product="Beta-galactosidase related protein"
FT                   /note="Beta-galactosidase related protein; FUNCTIONS IN:
FT                   hydrolase activity, hydrolyzing O-glycosyl compounds;
FT                   INVOLVED IN: carbohydrate metabolic process; CONTAINS
FT                   InterPro DOMAIN/s: Glycoside hydrolase, family 35
FT                   (InterPro:IPR001944); BEST Arabidopsis thaliana protein
FT                   match is: Beta-galactosidase related protein
FT                   (TAIR:AT5G35760.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01080"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01080.1"
FT                   /db_xref="GOA:F4K7X9"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7X9"
FT                   /inference="similar to RNA sequence, EST:INSD:ES063959.1"
FT                   /protein_id="AED90297.1"
FT                   /translation="MLLCWYNYISRTLPFEAPREIFHKTKRVKKNGTMIPSPQSGDYRS
FT                   FFNSSSPLPLIIELVHVQIIKFKDSSQIFKSLKKNGIITAFPWKSGYRSILNLFYPTAS
FT                   SLEFVSKSLYALFARAVYDHPLVEDFAKLVFMVESAIVSTDFSTIANFLKVNIPLENSW
FT                   NLYLSFCCIIVACINFPLLRP"
     atgttgcttt gttggtacaa ttatatctcg agaaccctgc ctttcgaagc acctagagag        60
     atttttcata aaaccaaaag agtgaagaag aacggcacta tgatcccgtc tccacagagc       120
     ggtgattacc gtagcttttt caactcttca tccccgcttc ctttgattat cgagctcgtt       180
     catgtgcaaa tcatcaagtt caaggatagt tctcaaattt ttaaaagctt gaagaagaac       240
     ggcattataa ccgcatttcc atggaaaagt ggttaccgta gtattctcaa tcttttttat       300
     ccaacagcct cctctttgga gtttgtttct aaaagcttgt atgcattgtt tgctcgagcc       360
     gtctatgacc acccgttggt cgaggatttc gcgaagctcg tcttcatggt cgaatccgct       420
     atagtttcaa cagatttttc aaccattgca aactttttaa aagtgaacat ccctttggaa       480
     aactcatgga acttgtatct ttctttctgt tgtattatcg tagcttgtat caactttcct       540
     ctcttgaggc cttaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page