(data stored in ACNUC13479 zone)

EMBL: CP002688.PE21

CP002688.PE21        Location/Qualifiers
FT   CDS_pept        33055..34116
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.70"
FT                   /gene_synonym="F7J8_70"
FT                   /locus_tag="AT5G01090"
FT                   /product="Concanavalin A-like lectin family protein"
FT                   /note="Concanavalin A-like lectin family protein; FUNCTIONS
FT                   IN: carbohydrate binding, binding; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: endomembrane
FT                   system; EXPRESSED IN: 22 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Legume lectin, beta chain (InterPro:IPR001220),
FT                   Concanavalin A-like lectin/glucanase, subgroup
FT                   (InterPro:IPR013320), Concanavalin A-like lectin/glucanase
FT                   (InterPro:IPR008985); BEST Arabidopsis thaliana protein
FT                   match is: Concanavalin A-like lectin family protein
FT                   (TAIR:AT3G09190.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFC7"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CB259122.1,INSD:EL254872.1,INSD:ES181783.1,
FT                   INSD:EL999500.1,INSD:BP779861.1,INSD:ES102589.1,
FT                   INSD:ES059209.1,INSD:AU227487.1,INSD:EL115606.1,
FT                   INSD:ES060963.1,INSD:ES194348.1,INSD:EL138001.1,
FT                   INSD:ES095586.1,INSD:ES130862.1,INSD:CB259782.1,
FT                   INSD:BP659977.1,INSD:EH968387.1,INSD:ES171696.1,
FT                   INSD:EL200584.1,INSD:BP661371.1,INSD:BP593608.1,
FT                   INSD:AU236536.1,INSD:ES110178.1,INSD:ES009620.1,
FT                   INSD:EL200793.1,INSD:ES214075.1,INSD:DR376811.1,
FT                   INSD:AV557596.1,INSD:ES050811.1,INSD:EH798333.1,
FT                   INSD:BP860691.1,INSD:EL246126.1,INSD:T45244.1,
FT                   INSD:ES181749.1,INSD:EH854912.1,INSD:EH910126.1,
FT                   INSD:F13962.1,INSD:BP841481.1,INSD:BP640127.1,
FT                   INSD:ES176887.1,INSD:ES094966.1,INSD:ES089834.1,
FT                   INSD:F14046.1,INSD:EL985127.1,INSD:EL970808.1,
FT                   INSD:EL098094.1,INSD:AV534557.1,INSD:EH814314.1,
FT                   INSD:EL105261.1,INSD:ES097721.1,INSD:ES191355.1,
FT                   INSD:ES151590.1,INSD:DR231932.1,INSD:T45690.1,
FT                   INSD:EL010969.1,INSD:BP829595.1,INSD:EL160234.1,
FT                   INSD:EL992313.1,INSD:EL312062.1,INSD:ES041377.1,
FT                   INSD:ES038430.1,INSD:BP827058.1,INSD:DR231933.1,
FT                   INSD:ES108134.1,INSD:EG439761.1,INSD:BP588343.1,
FT                   INSD:BP821480.1,INSD:ES074194.1,INSD:EH983067.1,
FT                   INSD:EL267397.1,INSD:EH802366.1,INSD:ES018470.1,
FT                   INSD:EL984625.1,INSD:ES093387.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832720.1,INSD:AY088097.1,INSD:BX832388.1,
FT                   INSD:BX832299.1,INSD:AK228471.1,INSD:BX829725.1"
FT                   /protein_id="AED90298.1"
FT                   /translation="MAVFKTLAFLFVLSIVIYQSVAVTDVNSSFSFNGFVKAPSFDNNV
FT                   ALFGDSKLVHGGPSIQLTDSVSRSEGRVIYKKPIRLFQGKERNFSGSFSTSFSFSMSDE
FT                   IGSVLAFIMVPRGLDLRLFGRKGNNSSSGLGFLLKHKVVAVEFGISKRGNHVGILVGRP
FT                   ESGKVRKLSSFGHHFNEEKRLNCWIDYEASSKRIEVRLSLSAALKPVDPFVSYSVDLAK
FT                   LWKDGKFMVGLTSANGNTSKPVYLHSWSFKLRHPSMRIHSQPLDPNDVSKTVKEGEKTV
FT                   EVKGKGKCIWRILGALVLGAVCGTLGAMFALYLWTICGNRQSMAIVPEECADEKADILV
FT                   TKADVVVEEEVKK"
     atggcggtct tcaaaaccct agctttccta ttcgttttaa gcatcgtgat ttaccaatca        60
     gtggctgtta cagatgtaaa ttcatcgttt tcctttaatg ggtttgtgaa agctccaagc       120
     tttgacaata atgttgctct gtttggagat tcgaagctcg ttcatggcgg tccatcgata       180
     caattgactg actcagtgag tcgcagtgaa gggcgagtta tttacaagaa acccatcaga       240
     ctgttccaag gtaaagagag aaacttttcc ggatcattct caactagttt ctcgttttcg       300
     atgtctgatg agattggtag tgtcttggct tttataatgg ttccaagagg tttggatctt       360
     aggttgtttg gtagaaaggg taataatagt tcctctggtt tagggttctt attgaaacac       420
     aaagttgttg ctgttgagtt tggtatctcc aagagaggga atcatgtagg gatcttagtt       480
     ggtcgtcctg aatctggtaa agttagaaag ttatcatctt ttggtcacca tttcaatgaa       540
     gagaagagat tgaattgttg gattgattat gaggcaagct caaagagaat agaggttcgt       600
     ttgagtctat ctgctgcctt aaagccggtg gatccattcg tgtcttactc tgtagacttg       660
     gctaagctat ggaaagatgg gaagtttatg gtgggtttaa cctctgcaaa tggaaacact       720
     tcaaagccgg tttatctcca ttcgtggagc tttaaactga gacatccttc gatgaggatt       780
     cactcgcagc cgcttgatcc aaacgacgtt tccaagactg ttaaggaagg ggagaagacg       840
     gtggaagtta aggggaaagg aaaatgtata tggagaatcc ttggtgcatt ggttttgggg       900
     gcggtttgtg gaacattggg agccatgttc gcgttatacc tttggacaat atgcggtaat       960
     aggcagtcaa tggcgatagt tcccgaggaa tgtgctgacg aaaaagcgga tatccttgta      1020
     acgaaagctg atgttgttgt tgaagaagaa gtcaagaagt ag                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page