(data stored in ACNUC13479 zone)

EMBL: CP002688.PE23

CP002688.PE23        Location/Qualifiers
FT   CDS_pept        complement(42114..44387)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.90"
FT                   /gene_synonym="F7J8_90"
FT                   /locus_tag="AT5G01110"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01110"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BGD3"
FT                   /protein_id="ANM70669.1"
FT                   /translation="MNQTTVKVFKFQFLFSIEIKLSLSQPQKMIVHRIIPSRVKDPLTR
FT                   FKPLKNLTTSSSPVFEPSSSSSSSSSSASFSVSDSFLVEKICFSLKQGNNNVRNHLIRL
FT                   NPLAVVEVLYRCRNDLTLGQRFVDQLGFHFPNFKHTSLSLSAMIHILVRSGRLSDAQSC
FT                   LLRMIRRSGVSRLEIVNSLDSTFSNCGSNDSVFDLLIRTYVQARKLREAHEAFTLLRSK
FT                   GFTVSIDACNALIGSLVRIGWVELAWGVYQEISRSGVGINVYTLNIMVNALCKDGKMEK
FT                   VGTFLSQVQEKGVYPDIVTYNTLISAYSSKGLMEEAFELMNAMPGKGFSPGVYTYNTVI
FT                   NGLCKHGKYERAKEVFAEMLRSGLSPDSTTYRSLLMEACKKGDVVETEKVFSDMRSRDV
FT                   VPDLVCFSSMMSLFTRSGNLDKALMYFNSVKEAGLIPDNVIYTILIQGYCRKGMISVAM
FT                   NLRNEMLQQGCAMDVVTYNTILHGLCKRKMLGEADKLFNEMTERALFPDSYTLTILIDG
FT                   HCKLGNLQNAMELFQKMKEKRIRLDVVTYNTLLDGFGKVGDIDTAKEIWADMVSKEILP
FT                   TPISYSILVNALCSKGHLAEAFRVWDEMISKNIKPTVMICNSMIKGYCRSGNASDGESF
FT                   LEKMISEGFVPDCISYNTLIYGFVREENMSKAFGLVKKMEEEQGGLVPDVFTYNSILHG
FT                   FCRQNQMKEAEVVLRKMIERGVNPDRSTYTCMINGFVSQDNLTEAFRIHDEMLQRGFSP
FT                   DDKF"
     atgaaccaaa ctactgtaaa agttttcaag tttcaatttt tgttctcaat cgaaatcaaa        60
     ttgagtctct ctcaaccaca aaaaatgatt gttcaccgta taataccttc ccgcgtaaaa       120
     gaccctctca ctcgatttaa acctctcaaa aacttgacaa cttcttcatc tcccgtattc       180
     gaaccctctt cttcttcttc ttcttcttct tcttcggctt cgttttctgt ttcagattct       240
     ttcttggtgg agaagatttg ttttagtttg aagcaaggta acaataatgt gagaaaccac       300
     ctgattcggt taaacccttt agccgtcgtt gaggttttat accgctgccg caatgattta       360
     actttaggtc aaagattcgt ggatcaatta ggtttccatt ttccgaattt caagcatacg       420
     tctttgtctt taagcgctat gattcatatt ctcgtgagga gtggaagatt atcagatgca       480
     cagagttgtc ttcttaggat gattaggagg agtggtgttt ctagactaga gattgtgaat       540
     tccttggatt ctacgtttag taattgtggt tccaatgatt cggtttttga tttgttgatt       600
     aggacttatg ttcaggctag gaaacttaga gaagcacatg aggcttttac attgctgaga       660
     agcaaaggtt ttacggtttc tatcgatgcg tgtaacgctc ttatcgggag cttggtgagg       720
     atcgggtggg ttgaactggc ttggggtgtt tatcaggaga tttctcggag tggtgttggt       780
     attaatgtct atactctcaa tatcatggtt aatgctttgt gcaaagatgg taaaatggaa       840
     aaagtcggaa cctttttatc acaagtgcaa gagaaagggg tttatccgga tattgtaaca       900
     tataatacat tgattagtgc ctactctagt aaaggtctca tggaagaggc atttgagttg       960
     atgaatgcta tgccgggcaa agggtttagt cctggtgttt atacttataa tactgtgata      1020
     aatggactgt gtaagcatgg gaaatatgag agagccaagg aagttttcgc ggagatgtta      1080
     agatccgggt tgagtcctga ctccactacc tacagatcgt tgctgatgga ggcttgtaag      1140
     aagggagatg tggttgaaac ggaaaaggtt ttcagtgata tgagatctag agatgttgtt      1200
     cctgatttgg tttgctttag ctcgatgatg agtcttttta ctcggagtgg aaatctcgat      1260
     aaggcattaa tgtattttaa cagtgtgaag gaggctggtc tgattcctga caatgtgatc      1320
     tataccattc ttatccaagg gtattgtaga aaaggtatga tctctgtagc tatgaatttg      1380
     agaaatgaaa tgcttcagca gggttgtgct atggatgttg ttacctacaa caccattttg      1440
     catggcttat gcaaacggaa aatgttgggt gaagcggata aattgttcaa cgaaatgact      1500
     gaaagggctt tgtttccaga ttcttatact ttaactatac tgattgatgg acattgtaag      1560
     ctcgggaatc tgcagaacgc aatggagctc tttcaaaaga tgaaggaaaa gagaatcaga      1620
     ctcgatgttg tgacatacaa cactctgtta gatgggtttg gtaaagtagg cgatatcgat      1680
     acagcaaaag agatatgggc agatatggta tcaaaagaga tacttcccac tccaatatct      1740
     tacagcattt tggttaacgc gttgtgcagt aaaggccatc tggctgaggc atttcgagtt      1800
     tgggatgaaa tgatcagtaa aaatataaag ccaacggtaa tgatttgtaa ctctatgata      1860
     aagggatatt gtcgttctgg taatgcctca gatggagaaa gctttttaga gaagatgatc      1920
     tcggaaggtt ttgtgccgga ttgcatcagt tacaacacat taatatatgg ttttgttaga      1980
     gaagaaaaca tgagcaaagc ttttggtttg gtaaagaaga tggaggagga gcaaggagga      2040
     ttagtacctg atgtatttac atataattcg atcttacatg ggttttgtag acaaaatcag      2100
     atgaaagaag ccgaggttgt gctaaggaag atgatcgaga gaggtgtcaa tcccgatagg      2160
     tcaacgtata cttgtatgat caatggattt gtttctcaag ataacttaac cgaggcattt      2220
     cggattcacg atgagatgct gcaaagagga ttctctcctg atgataaatt ctga            2274
//

If you have problems or comments...

PBIL Back to PBIL home page