(data stored in ACNUC13479 zone)

EMBL: CP002688.PE24

CP002688.PE24        Location/Qualifiers
FT   CDS_pept        complement(42114..44303)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.90"
FT                   /gene_synonym="F7J8_90"
FT                   /locus_tag="AT5G01110"
FT                   /product="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein"
FT                   /note="Tetratricopeptide repeat (TPR)-like superfamily
FT                   protein; LOCATED IN: chloroplast; CONTAINS InterPro
FT                   DOMAIN/s: Pentatricopeptide repeat (InterPro:IPR002885);
FT                   BEST Arabidopsis thaliana protein match is:
FT                   Pentatricopeptide repeat (PPR-like) superfamily protein
FT                   (TAIR:AT1G05670.2); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01110"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFC5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU227497.1,INSD:AU236546.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK228473.1,INSD:BT005783.1"
FT                   /protein_id="AED90300.1"
FT                   /translation="MIVHRIIPSRVKDPLTRFKPLKNLTTSSSPVFEPSSSSSSSSSSA
FT                   SFSVSDSFLVEKICFSLKQGNNNVRNHLIRLNPLAVVEVLYRCRNDLTLGQRFVDQLGF
FT                   HFPNFKHTSLSLSAMIHILVRSGRLSDAQSCLLRMIRRSGVSRLEIVNSLDSTFSNCGS
FT                   NDSVFDLLIRTYVQARKLREAHEAFTLLRSKGFTVSIDACNALIGSLVRIGWVELAWGV
FT                   YQEISRSGVGINVYTLNIMVNALCKDGKMEKVGTFLSQVQEKGVYPDIVTYNTLISAYS
FT                   SKGLMEEAFELMNAMPGKGFSPGVYTYNTVINGLCKHGKYERAKEVFAEMLRSGLSPDS
FT                   TTYRSLLMEACKKGDVVETEKVFSDMRSRDVVPDLVCFSSMMSLFTRSGNLDKALMYFN
FT                   SVKEAGLIPDNVIYTILIQGYCRKGMISVAMNLRNEMLQQGCAMDVVTYNTILHGLCKR
FT                   KMLGEADKLFNEMTERALFPDSYTLTILIDGHCKLGNLQNAMELFQKMKEKRIRLDVVT
FT                   YNTLLDGFGKVGDIDTAKEIWADMVSKEILPTPISYSILVNALCSKGHLAEAFRVWDEM
FT                   ISKNIKPTVMICNSMIKGYCRSGNASDGESFLEKMISEGFVPDCISYNTLIYGFVREEN
FT                   MSKAFGLVKKMEEEQGGLVPDVFTYNSILHGFCRQNQMKEAEVVLRKMIERGVNPDRST
FT                   YTCMINGFVSQDNLTEAFRIHDEMLQRGFSPDDKF"
     atgattgttc accgtataat accttcccgc gtaaaagacc ctctcactcg atttaaacct        60
     ctcaaaaact tgacaacttc ttcatctccc gtattcgaac cctcttcttc ttcttcttct       120
     tcttcttctt cggcttcgtt ttctgtttca gattctttct tggtggagaa gatttgtttt       180
     agtttgaagc aaggtaacaa taatgtgaga aaccacctga ttcggttaaa ccctttagcc       240
     gtcgttgagg ttttataccg ctgccgcaat gatttaactt taggtcaaag attcgtggat       300
     caattaggtt tccattttcc gaatttcaag catacgtctt tgtctttaag cgctatgatt       360
     catattctcg tgaggagtgg aagattatca gatgcacaga gttgtcttct taggatgatt       420
     aggaggagtg gtgtttctag actagagatt gtgaattcct tggattctac gtttagtaat       480
     tgtggttcca atgattcggt ttttgatttg ttgattagga cttatgttca ggctaggaaa       540
     cttagagaag cacatgaggc ttttacattg ctgagaagca aaggttttac ggtttctatc       600
     gatgcgtgta acgctcttat cgggagcttg gtgaggatcg ggtgggttga actggcttgg       660
     ggtgtttatc aggagatttc tcggagtggt gttggtatta atgtctatac tctcaatatc       720
     atggttaatg ctttgtgcaa agatggtaaa atggaaaaag tcggaacctt tttatcacaa       780
     gtgcaagaga aaggggttta tccggatatt gtaacatata atacattgat tagtgcctac       840
     tctagtaaag gtctcatgga agaggcattt gagttgatga atgctatgcc gggcaaaggg       900
     tttagtcctg gtgtttatac ttataatact gtgataaatg gactgtgtaa gcatgggaaa       960
     tatgagagag ccaaggaagt tttcgcggag atgttaagat ccgggttgag tcctgactcc      1020
     actacctaca gatcgttgct gatggaggct tgtaagaagg gagatgtggt tgaaacggaa      1080
     aaggttttca gtgatatgag atctagagat gttgttcctg atttggtttg ctttagctcg      1140
     atgatgagtc tttttactcg gagtggaaat ctcgataagg cattaatgta ttttaacagt      1200
     gtgaaggagg ctggtctgat tcctgacaat gtgatctata ccattcttat ccaagggtat      1260
     tgtagaaaag gtatgatctc tgtagctatg aatttgagaa atgaaatgct tcagcagggt      1320
     tgtgctatgg atgttgttac ctacaacacc attttgcatg gcttatgcaa acggaaaatg      1380
     ttgggtgaag cggataaatt gttcaacgaa atgactgaaa gggctttgtt tccagattct      1440
     tatactttaa ctatactgat tgatggacat tgtaagctcg ggaatctgca gaacgcaatg      1500
     gagctctttc aaaagatgaa ggaaaagaga atcagactcg atgttgtgac atacaacact      1560
     ctgttagatg ggtttggtaa agtaggcgat atcgatacag caaaagagat atgggcagat      1620
     atggtatcaa aagagatact tcccactcca atatcttaca gcattttggt taacgcgttg      1680
     tgcagtaaag gccatctggc tgaggcattt cgagtttggg atgaaatgat cagtaaaaat      1740
     ataaagccaa cggtaatgat ttgtaactct atgataaagg gatattgtcg ttctggtaat      1800
     gcctcagatg gagaaagctt tttagagaag atgatctcgg aaggttttgt gccggattgc      1860
     atcagttaca acacattaat atatggtttt gttagagaag aaaacatgag caaagctttt      1920
     ggtttggtaa agaagatgga ggaggagcaa ggaggattag tacctgatgt atttacatat      1980
     aattcgatct tacatgggtt ttgtagacaa aatcagatga aagaagccga ggttgtgcta      2040
     aggaagatga tcgagagagg tgtcaatccc gataggtcaa cgtatacttg tatgatcaat      2100
     ggatttgttt ctcaagataa cttaaccgag gcatttcgga ttcacgatga gatgctgcaa      2160
     agaggattct ctcctgatga taaattctga                                       2190
//

If you have problems or comments...

PBIL Back to PBIL home page