(data stored in ACNUC13479 zone)

EMBL: CP002688.PE25

CP002688.PE25        Location/Qualifiers
FT   CDS_pept        join(45281..45928,46012..46761,46852..46986)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.100"
FT                   /gene_synonym="F7J8_100"
FT                   /locus_tag="AT5G01120"
FT                   /product="hypothetical protein (DUF674)"
FT                   /note="Protein of unknown function (DUF674); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF674
FT                   (InterPro:IPR007750); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF674)
FT                   (TAIR:AT5G43240.3); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01120"
FT                   /db_xref="InterPro:IPR007750"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG448915.1,INSD:EG448885.1,INSD:EG448928.1,
FT                   INSD:EG448920.1,INSD:EG448918.1,INSD:EG448914.1,
FT                   INSD:EG448916.1,INSD:EG448884.1,INSD:EG448927.1,
FT                   INSD:EG448917.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY735669.1"
FT                   /protein_id="AED90301.1"
FT                   /translation="MSDDFENSVINLKLLIDEEKNKVVFAEAGTDFVDILFSFSTLPMG
FT                   TIVRLLEMHHKSRSIAIGCFNNIYASVVSMGMKHFSTQACKQMLLFPGSLNQDKCQNMK
FT                   LKIDDSEATKCFMCPMFVRSGQCSKGYSNFKTSRCSCGNFMDEVIQFQGEGGRGNGSQA
FT                   EVFVRGAHTSFIITDDLKVQVNSVGSTLNVLKDLAYADCDKLVEMILEVNLQEVATLLV
FT                   CLFTSDTPLTDTFLKKKSSHGMNRIHKRPSPSLSEDREETKADQTIMLNAYVRKEEGNI
FT                   LYVECGDDFVDLLFSFLAMPLESVWDISGRGIILGCIGNLCKSFKDLSSASATEASAFK
FT                   CVLPHYYKCQKQLLNDVVTTHQPPTYYRFVSFSADHFREYRLSENSGKRLVYDWDKLVP
FT                   VTSIDPKTEGNNTAETSGFVKRGTKFMVTDDLIINPSNSTSTIGFLKEKQTRLDEVEIR
FT                   VINMTKEEAIRLLGASMVTSSALSTGLLAMESASTSDPKCRFFKKPKIETET"
     atgtcagacg atttcgagaa ttcggtgata aacttgaagc tgctcataga tgaagagaaa        60
     aacaaagttg tattcgctga ggcgggtaca gattttgtcg atatactctt tagcttttcg       120
     actttgccta tgggaacaat tgttagattg ctggagatgc atcacaagtc acgctcaata       180
     gccattggtt gtttcaacaa catctatgca agtgttgtga gtatgggaat gaagcatttc       240
     agtactcaag cttgcaagca aatgcttttg tttcctggga gtttgaatca ggacaaatgt       300
     caaaatatga agctgaagat agatgattcc gaggctacca agtgtttcat gtgtcctatg       360
     tttgtgcgaa gcggacaatg cagcaaaggc tatagcaatt ttaagacctc taggtgtagc       420
     tgtgggaatt tcatggatga ggtgattcag tttcaaggag aaggtggccg aggaaatggt       480
     tctcaagctg aagtatttgt gaggggtgct catacttcat tcataatcac tgatgatttg       540
     aaagtgcaag ttaactctgt tgggtcaacg cttaatgttc ttaaagatct tgcctatgca       600
     gattgcgata agttggttga aatgattctt gaggtgaatc tccaagaggt agcgactttg       660
     ctggtgtgtt tgttcacatc ggatactcca ttgaccgata catttctgaa aaagaaaagc       720
     tcacatggta tgaacaggat tcataaaagg ccgagtcctt ctctcagtga agatagagag       780
     gaaacaaaag ctgatcaaac gataatgctc aatgcgtatg ttaggaagga ggaagggaac       840
     attctatatg ttgaatgtgg tgacgacttt gttgatcttc ttttctcttt ccttgctatg       900
     cctctggaat ctgtatggga catctcgggc agaggaatca tccttggatg cattggaaac       960
     ttgtgcaaaa gcttcaagga tttgagtagt gcttccgcaa ctgaagcttc agcttttaaa      1020
     tgtgttcttc ctcattacta caagtgccag aagcagctgc taaatgatgt tgtcacaacc      1080
     catcagccac caacttatta ccgttttgta tcgttctctg cggatcattt tcgagagtac      1140
     cgtttgtctg aaaactctgg taagcgactt gtgtatgact gggataaact cgtgcctgtg      1200
     acttcgatag atccgaaaac cgaaggcaac aacactgctg aaacaagtgg atttgtgaag      1260
     agagggacaa agttcatggt gacagatgat ctgatcatta atccttcgaa ctcaacctca      1320
     accattggat tcttaaagga gaaacagact cgactagatg aagttgaaat tcgagtgatc      1380
     aatatgacaa aagaagaggc catcagatta ttgggagctt caatggtgac atcctctgcc      1440
     ttaagcactg gtctgctagc tatggaatca gcttcaacaa gtgatcctaa atgccggttt      1500
     tttaagaagc cgaagattga gacagagact tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page