(data stored in ACNUC13479 zone)

EMBL: CP002688.PE26

CP002688.PE26        Location/Qualifiers
FT   CDS_pept        join(47642..48253,48355..49005,49079..49174)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.110"
FT                   /gene_synonym="F7J8_110"
FT                   /locus_tag="AT5G01130"
FT                   /product="hypothetical protein (DUF674)"
FT                   /note="Protein of unknown function (DUF674); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF674
FT                   (InterPro:IPR007750); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF674)
FT                   (TAIR:AT5G01150.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01130"
FT                   /db_xref="InterPro:IPR007750"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7Y4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG492395.1,INSD:EG524343.1,INSD:EG523695.1,
FT                   INSD:EG523704.1,INSD:EG523703.1,INSD:EG492399.1,
FT                   INSD:EG492400.1,INSD:EG524354.1,INSD:EG524346.1,
FT                   INSD:EG524352.1,INSD:EG524340.1,INSD:EG523699.1,
FT                   INSD:EG429963.1,INSD:EG523697.1,INSD:EG492397.1,
FT                   INSD:EG492402.1,INSD:EG524338.1,INSD:EG492398.1,
FT                   INSD:EG492403.1,INSD:EG524357.1,INSD:EG523694.1,
FT                   INSD:EG523696.1,INSD:EG523691.1,INSD:EG524341.1,
FT                   INSD:EG523693.1,INSD:EG524339.1,INSD:EG524355.1,
FT                   INSD:EG523692.1,INSD:EG523643.1,INSD:EG524353.1,
FT                   INSD:EG492394.1,INSD:EG524342.1,INSD:EG524347.1,
FT                   INSD:EG492393.1,INSD:EG492401.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:DQ653258.1"
FT                   /protein_id="AED90302.1"
FT                   /translation="MAESSEEPKVSLRLFIDEEKNKVVLAEASKAFVDVLFSLLTLPMG
FT                   TIIRLLEEHRESQPITVGCFSNLYRSVAEMGIDNFKTDVCKHILLHPRSVRDLQYKRLM
FT                   LNINPTEVKLFKCPISCNFYSHFSTSRCQCGSSMNKEFQEPRVVPVASSIQNDVNGVFI
FT                   ITDDLKVAVRSTDVVLNELKSLGSGDISKLREMLVYIGFEEVLTLLECMFSSKAPLTNT
FT                   FLNKQTFQGQGVTKVYETLSPCMETNGDTFLTLDVIVRKQDMEILYVECGEDFVDLLFT
FT                   FLAVPLEYVVGISGNSCSFVCIRNLIRSFKDLNAAEVSTSKSAIHHFYTCQKQLLNIIT
FT                   DQPPLYHRYNYYSLKECSGSTPLILIDPEGSGFVKRETKFTVSDDLIVTAMNSSSPICL
FT                   LQKFQIHADDLEVQQISTSKTEATSLLRASLVTSSALKTSLRNLILKNPEEEI"
     atggctgaaa gttctgaaga accaaaggtc agtctgagac tcttcattga tgaagagaaa        60
     aacaaagtcg tattggctga ggctagtaag gcttttgttg acgtgctctt cagccttctg       120
     acattgccaa tgggcaccat tatcagattg cttgaggagc atcgagaatc tcaaccaatt       180
     actgttggct gttttagcaa cctatataga agtgttgccg agatgggcat tgacaacttc       240
     aaaactgatg tttgcaagca tatattgctt catccaagga gtgtgaggga tctacagtac       300
     aaaaggctta tgctcaacat aaaccctact gaggtcaagc tcttcaagtg tccaatttca       360
     tgcaatttct acagtcattt tagcacttct cgatgccaat gtggaagttc gatgaacaag       420
     gagtttcaag aaccaagagt agtgccagtt gcaagcagca tacaaaatga tgttaatgga       480
     gtattcatca taactgatga cttgaaagtg gcagttaggt ccactgacgt tgtcttgaat       540
     gagctcaaat ccctaggctc cggtgatatt agtaagctcc gcgaaatgct tgtttatatc       600
     ggttttgaag aggtactaac tttgctggaa tgtatgttct cctcaaaagc tcccttgacg       660
     aacactttct tgaacaaaca aaccttccaa ggtcaaggtg tgaccaaagt ttatgaaact       720
     ttaagtccat gtatggagac aaatggagac acgtttttaa ctttggatgt gatagtaagg       780
     aagcaggaca tggagatttt atatgttgaa tgcggagaag actttgttga cctccttttc       840
     acgtttcttg ctgttccgct ggaatatgta gtgggaatct ctggtaacag ctgcagtttt       900
     gtgtgcatta gaaacttgat tagaagcttc aaagatttga atgctgcaga agtctcaacc       960
     tccaaatccg cgatccacca tttttataca tgtcagaagc agttgctcaa tatcatcact      1020
     gaccaacctc cgctctacca tcgctacaac tattatagct tgaaagagtg ttcgggctcg      1080
     actcctttga ttttgataga tccagaaggt agtggctttg tgaagagaga gacgaagttt      1140
     actgtatcgg atgatttgat tgttactgct atgaactcga gctcacctat ttgcttgctt      1200
     cagaagtttc agattcacgc agatgacctc gaggtgcaac aaataagtac cagcaaaaca      1260
     gaggctacga gtttgctgag agcttccttg gtaacatcct ctgcattgaa aacttcttta      1320
     aggaacttga ttttgaagaa ccccgaggaa gagatttga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page