(data stored in ACNUC13479 zone)

EMBL: CP002688.PE27

CP002688.PE27        Location/Qualifiers
FT   CDS_pept        join(49891..49975,50024..51222,51300..51437)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.120"
FT                   /gene_synonym="F7J8_120"
FT                   /locus_tag="AT5G01140"
FT                   /product="hypothetical protein (DUF674)"
FT                   /note="Protein of unknown function (DUF674); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF674
FT                   (InterPro:IPR007750); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF674)
FT                   (TAIR:AT5G01150.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="InterPro:IPR007750"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC2"
FT                   /protein_id="AED90303.1"
FT                   /translation="MAQSSTEPKFSLRLIIDEEKNKVVLAEAGTIVRLLAKHRKSDPVT
FT                   IGCLRNLYTSVVDMELDDFETDACKQMLLYPKNIREAQYRNFKLNIDTNESLKCFGCRF
FT                   FSICRMCSNFNTSLCKCGKLMNEEISFLEYEENDVEGVFMRDKSSFIITDDLRLTDDST
FT                   SSLLQTLKDLGCADVSKLREQVLDIGLKEVMTLMQCVFTSNTPLTDAFLKNQSSNTVRK
FT                   IYRKLSDDKGDEAEPDKVITIDAIVRKQDMKILYVECGEDFVDLLFTFLAIPLESIWEI
FT                   SGNSITIGRIGNLFRSFKDLSDNEVLSASKCMIPYYYRCQKQLLKIRTPTPRVYLGHCY
FT                   SKTLSYSQSFYLTTKRTTKRMTFVDPKSDCCGRSKDGKGFVKRGTKFIVSDDLIVTPKI
FT                   SSSTFSVLKKFQILTDDLEVQAITISNADALNLLGASLVTSSALSSAFGNLIVKKPKEE
FT                   NVSWNPVSKKPKVET"
     atggctcaga gttctacgga accaaagttt agtttgagac ttatcattga tgaagagaaa        60
     aacaaggttg ttttggctga ggctggaaca atcgtcagat tgcttgcaaa gcatcgaaag       120
     tctgatccag ttactattgg atgtcttaga aacctttata caagtgttgt ggacatggaa       180
     cttgatgatt ttgagactga tgcttgtaag cagatgttgc tttatcccaa gaacattagg       240
     gaggctcaat acagaaactt taagctcaac attgacacta atgaaagctt aaagtgtttt       300
     ggttgccgat ttttctcaat ctgcagaatg tgcagtaatt tcaacacgtc cctatgtaaa       360
     tgcggaaagc tgatgaatga ggagataagt ttcttagaat atgaggaaaa tgatgtcgaa       420
     ggagtattta tgagagacaa gtcgtcattt atcataaccg atgacttgag actcacggat       480
     gattctacta gttctctctt gcaaacactc aaagatcttg gttgtgctga tgttagtaag       540
     ctaagagagc aggttcttga tatcggtctc aaggaggtta tgactttgat gcaatgtgtt       600
     ttcacctcaa atacaccttt gacggatgct ttcttgaaga atcaaagttc aaacacggtg       660
     aggaagattt atagaaagct gagtgatgat aaaggagatg aagcagaacc agacaaagtt       720
     ataactattg atgctatagt aaggaaacag gacatgaaga ttttgtacgt tgagtgcggt       780
     gaagactttg ttgatcttct tttcactttt ctcgccattc cgttggagtc tatatgggaa       840
     atctctggta acagtattac aataggtcgc attgggaact tgttcagaag cttcaaagac       900
     ttgagtgata atgaagtgtt atcagcatcc aaatgtatga ttccgtatta ttataggtgc       960
     cagaaacagt tgctcaaaat aagaactcct acaccacggg tttacttagg acactgttat      1020
     tccaagacac tgtcttattc tcaaagcttt tatttgacta caaaacgtac tacaaagcgc      1080
     atgacttttg tggatccaaa atctgattgt tgtggtcggt caaaagatgg taaggggttt      1140
     gtgaagagag ggacaaagtt tattgtgtca gatgatctta ttgtaacacc taagatttct      1200
     agctcaacat tttccgtgtt gaagaagttt cagattctca cagatgattt ggaggtgcaa      1260
     gcaattacca tcagcaatgc agatgctttg aatctgttgg gagcttcatt ggtgacatcc      1320
     tctgctttga gctctgcttt tgggaatttg attgtgaaga aaccgaagga agagaatgtt      1380
     tcatggaacc cggtttcaaa gaaaccaaag gttgagactt ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page