(data stored in ACNUC13479 zone)

EMBL: CP002688.PE28

CP002688.PE28        Location/Qualifiers
FT   CDS_pept        join(51988..52623,52708..53439,53512..53649)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.130"
FT                   /gene_synonym="F7J8_130"
FT                   /locus_tag="AT5G01150"
FT                   /product="hypothetical protein (DUF674)"
FT                   /note="Protein of unknown function (DUF674); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF674
FT                   (InterPro:IPR007750); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF674)
FT                   (TAIR:AT5G01130.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01150"
FT                   /db_xref="GOA:Q9LFC1"
FT                   /db_xref="InterPro:IPR007750"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFC1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG523726.1,INSD:EG523718.1,INSD:EG523729.1,
FT                   INSD:EG469454.1,INSD:EG523720.1,INSD:EG523730.1,
FT                   INSD:EG523724.1,INSD:EG523701.1,INSD:EG523721.1,
FT                   INSD:EG523731.1,INSD:EG523728.1,INSD:EG523702.1,
FT                   INSD:EG523723.1,INSD:EG523719.1,INSD:EG469453.1,
FT                   INSD:EG523727.1,INSD:EG523725.1"
FT                   /protein_id="AED90304.1"
FT                   /translation="MAKSSEEPKFSLRLIVDEEKNKVVLAEACRDFVDVLFSLLTLPMG
FT                   TIVRLLENHRKSEPVTLGCFNNLYRSVVDMGSDCFETEACKQMLVYPKSVKDLQCKRLK
FT                   LNINPTEDIKCFKCSSYCGLYSNFSTSKCRCGKFMNEEIQLENEEQDLGRFQDDDNGVF
FT                   VSGRCSFVLTDDLEVSVKSTELVLNKLKSLGCADVGKLGERLLDIGVKEVLTLLGCIFS
FT                   SNAPLKDIFLNKKITQGATKFYKSQSPCLEKKEDEAEPEKVVTLKAFVRKQDMKILFVE
FT                   CGEEFVELLFSFIAVPLESAWEISGSSISLGCIGNMCRTFRDLNEETQMSTSTCALPSF
FT                   YNFQMQLPGIITQQPPVYYRYRLYDYRQMNYGLTTNGNRTTYYRKDRIVRVDLKDPKSR
FT                   GSDKSAQGFLKKATKCTVLDDLTITSMNSCSTVCLLKKLQSHADDLEVQVISISNAEAL
FT                   DLLRASLVTSSALSTTLWNLIAKKLKEETDLWDTVSKKVKEET"
     atggctaaaa gtagtgagga gcctaagttt tctttgagac ttattgttga tgaagagaaa        60
     aacaaggttg ttttggctga agcttgtagg gattttgttg atgtactctt cagccttctg       120
     acacttccaa tgggaaccat tgtcagattg cttgagaatc atcgaaaatc tgagccagta       180
     actctgggct gttttaacaa tctctataga agtgttgtgg acatgggcag tgattgtttt       240
     gagactgaag cttgtaagca gatgcttgtg tatccgaaga gtgtgaaaga cctccagtgc       300
     aaaaggctta agctcaacat aaaccctact gaggacatca agtgttttaa gtgctcaagt       360
     tactgcggct tgtacagtaa tttcagcacc tctaaatgtc gttgcggaaa atttatgaac       420
     gaggagattc agttagaaaa cgaggaacaa gatttaggcc ggtttcaaga tgatgataat       480
     ggagtatttg tcagcggtag gtgttcattc gtcttaaccg atgacttgga agtgtcagtc       540
     aagtccactg aacttgtctt gaataagctc aaatccttag gttgtgctga tgttggtaag       600
     ctcggtgaaa ggcttcttga tattggtgtg aaagaggtac tgactctgct gggatgtata       660
     ttctcctcaa atgctccctt aaaggacatt ttcttgaaca agaagattac acaaggtgcg       720
     acgaagtttt acaaatcgca aagtccatgt ttggagaaaa aagaagatga agcagaacct       780
     gaaaaggtag taactttgaa agcatttgtg aggaagcagg acatgaagat tttatttgtt       840
     gaatgcggag aggaatttgt tgagcttctt ttctctttta ttgctgtccc gcttgaatct       900
     gcatgggaaa tctctggcag cagtatctcc ttaggttgca taggaaacat gtgtagaacc       960
     ttcagggact taaatgagga gactcaaatg tcaacttcca catgcgcact tccgtctttc      1020
     tataatttcc agatgcaact gcctggtatt atcactcaac aacctccggt gtactaccgt      1080
     tacaggctct acgattacag gcaaatgaac tatggtttga ctacaaacgg taatcgaact      1140
     acttattacc gcaaagacag aatcgttcgg gtggatttga aggatcccaa atcccgtggc      1200
     agcgataagt ctgctcaggg gttcttgaag aaagcgacaa agtgtactgt attagatgat      1260
     ctgaccatta catctatgaa ctcctgctcc acagtttgtt tactaaagaa gttgcagagt      1320
     cacgcagacg atctagaggt gcaagtaatt agtatcagca atgcagaggc tttggatttg      1380
     ttgagagctt ccttggtgac atcctctgct ttgagcacga cattatggaa tttgattgct      1440
     aagaaactga aggaggagac tgatttatgg gacacggttt caaagaaagt gaaggaagag      1500
     acttga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page