(data stored in ACNUC13479 zone)

EMBL: CP002688.PE29

CP002688.PE29        Location/Qualifiers
FT   CDS_pept        join(54280..54534,54657..54715,54959..55727)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.140"
FT                   /gene_synonym="F7J8_140"
FT                   /locus_tag="AT5G01160"
FT                   /product="RING/U-box superfamily protein"
FT                   /db_xref="GOA:Q9LFC0"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR040380"
FT                   /db_xref="InterPro:IPR040383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFC0"
FT                   /protein_id="ANM69516.1"
FT                   /translation="MLQIRLRRDSPTETGNGARPSPTETVTVACPDHLVLADLPVAKGI
FT                   GSVTPTTVIKPVGRRSRRQLGERVHFCVRCDFPIAIYGRLIPCDHAFCLECARSDSICY
FT                   LCDERIQKIQTIKMMEGIFICAAPHCLRSFLKKLDFEAHVHDLHGSLLQADAEKEDGNQ
FT                   SDVQSTMQQSSASESTLRAPLRSQLQQSRELNRSASFAKSQSGFSQVQNYPPDSDNSRP
FT                   PGFETASPKPGIRFPDYPQPMNLMQPPSLPVPMNQNPGLPQQFGFPSYPTTESGSSQQF
FT                   FNGAQYEMTRTESGGSEQSSLLGYPPPSPMTNLNFQGSYPPPSWNPGMAPPHTTQQVNR
FT                   GRDGQSFGWPQENRDGFGQE"
     atgcttcaaa ttcgtcttcg gagggattcc ccgacggaaa ctggaaatgg tgcgaggcct        60
     tctccgacgg agacggttac tgtagcctgt cccgaccatc tcgtcctcgc cgatcttcct       120
     gttgcgaaag gaatcggttc cgtgactccc accaccgtaa tcaagcccgt cggtcgtcgt       180
     tctcgccgtc agctaggcga gagagttcac ttctgcgttc gttgcgattt tccgattgca       240
     atctatggtc gtctgattcc ttgtgatcat gccttttgcc ttgaatgtgc tcgcagtgat       300
     tccatctgct atctatgtga tgagcggatt cagaagattc aaacaatcaa gatgatggaa       360
     gggatcttca tctgtgcagc tcctcattgt cttaggtctt tcctgaagaa acttgacttt       420
     gaagcccatg tccatgacct ccatggaagc ctattacaag ccgatgcaga gaaagaagat       480
     ggtaaccagt cagatgttca gagcacaatg cagcagtctt cagcttcaga atccaccttg       540
     cgagctcctt taagatccca gctgcaacaa tcccgtgaac taaacaggtc ggcgtcattt       600
     gcaaagtcac agtctggatt tagtcaagtc cagaattacc ctccagatag cgataactct       660
     cgccctcctg gattcgaaac cgctagtcct aaaccaggaa tccggttccc agactacccc       720
     cagcctatga atcttatgca accgcccagc ttgcccgttc caatgaatca aaacccgggt       780
     ttaccacagc agtttggttt tccttcgtat ccaacaacag agagtggatc atctcaacaa       840
     ttctttaacg gtgctcagta cgagatgaca agaacagaga gcggcggatc agaacaaagt       900
     tcattgctcg ggtatccccc gccttcacca atgacgaatc tgaatttcca aggatcgtat       960
     cctcctccat catggaatcc cggaatggca ccgcctcaca cgacccagca ggttaaccgg      1020
     ggtagagacg gtcaaagttt tgggtggcca caagagaacc gtgatggctt tgggcaggag      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page