(data stored in ACNUC13479 zone)

EMBL: CP002688.PE31

CP002688.PE31        Location/Qualifiers
FT   CDS_pept        58315..60021
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.150"
FT                   /gene_synonym="F7J8_150"
FT                   /locus_tag="AT5G01170"
FT                   /product="hypothetical protein (DUF740)"
FT                   /note="Protein of unknown function (DUF740); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF740
FT                   (InterPro:IPR008004); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF740)
FT                   (TAIR:AT3G09070.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01170"
FT                   /db_xref="GOA:Q9LFB9"
FT                   /db_xref="InterPro:IPR008004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFB9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR236106.1,INSD:ES163573.1,INSD:AU227549.1,
FT                   INSD:DR369859.1,INSD:DR199830.1,INSD:AU236596.1,
FT                   INSD:DR383575.1,INSD:DR369948.1,INSD:DR350065.1,
FT                   INSD:DR383601.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT004217.1,INSD:BT015922.1"
FT                   /protein_id="AED90306.1"
FT                   /translation="MNLSADQAPVTAVDELAPPSQPHRLSTSCDLHPEERFSGFCPSCL
FT                   CDRLSVLDHNAAPPPSSSSRKPPSISAVSLKALFKPSSSGTNNSNGNGRVRPGFFPELR
FT                   RTKSFSAKNNEGFSGGFEPQRRSCDVRLRDDERNLPINEAASVDKIEEEARESSVSEIV
FT                   LEVTEEAEIEEDEENGEKDPGEIVEEKSSEIGEEEEELKPMKDYMDLYSQTKKPSVKDF
FT                   AGSFFSAASVFSKKLQKWKQKQKVKKPRNGVGGGRPQSEIGVGRRSSDTDPRFSLDAGR
FT                   FSVDIGRISMDDSRYSLDEPRASWDGHLIGRTTAARVPLPPSMLSVVENAPLNRSDMQI
FT                   PSSPSIKPISGDSDPIIIIPGGSNQTRDYYTGPPSSRRRKSLDRSNSIRKIVTELEDVK
FT                   SVSNSTTTIDSNSMETAENKGNQNGDKKSRRWGKWSILGFIYRKGKDDEEEDRYSRSNS
FT                   AGMVERSLSESWPEMRNGEGGGPKMRRSNSNVSWRSSGGGSARNKSSRYSSKDGENGML
FT                   RFYLTPMRRSWKTSGGSGGGGGGGGGGGWEKTAAKANSHGHSIARRVMRLY"
     atgaatctct ccgccgacca agctcccgtc accgccgtcg acgaactagc tccgccttct        60
     caaccgcatc gcttatctac atcatgtgat ctccacccag aagagcgttt ctccggtttc       120
     tgtccttctt gtctttgcga ccgcctctcc gtcttagatc acaacgccgc tccgccaccg       180
     tcttcttctt cccggaaacc tccctctatc tccgctgttt cgttaaaagc tctcttcaag       240
     ccctcctcta gtggtaccaa caactccaac ggaaacggtc gggtcagacc cggtttcttc       300
     ccggagctcc gacgtacaaa gtccttttcc gcaaagaaca acgaaggatt ttccggtggg       360
     tttgagccac agcgtcggtc ttgtgacgtc agacttcgtg acgacgaaag aaaccttccc       420
     atcaatgaag ctgcctccgt cgataaaatc gaggaggagg ctagggagtc tagcgtgagt       480
     gagatagttt tagaggtgac tgaagaagct gaaattgagg aggatgaaga aaacggtgag       540
     aaagatcccg gcgagatagt tgaggaaaaa agcagcgaaa ttggtgagga agaagaggaa       600
     ttgaagccaa tgaaggatta catggatctc tactcacaaa caaagaaacc gtcggtgaaa       660
     gatttcgccg ggagtttctt ttcggcggcc tctgttttca gcaagaagct tcagaaatgg       720
     aagcagaagc agaaggtgaa gaagccgaga aacggtgtcg gcggaggacg gccacagtct       780
     gaaatcggag taggccggag atcaagcgac accgacccga gattctctct tgacgccggg       840
     agattctccg tcgatatagg tcggatttca atggacgatt ctcgctactc attagatgag       900
     ccaagagcgt cgtgggatgg acacttaatc ggcaggacaa cggcggctag ggttcctctg       960
     ccgccatcga tgttatcagt tgtggaaaat gctccgttga atcgatcaga catgcagatt      1020
     ccatcgtctc cgtcaattaa accgattagc ggtgactccg acccgattat cataatccca      1080
     ggcggatcca atcaaactcg agactactac actggacctc cgtcgtcacg gagacggaag      1140
     agcctcgaca gatccaattc tattagaaaa attgtaacgg agctagagga tgtcaaatcg      1200
     gtatcaaatt cgacaacaac aatagactca aattccatgg aaacagcgga gaacaaaggg      1260
     aatcaaaacg gcgataagaa atcgagacgg tggggaaaat ggagcatttt agggtttata      1320
     tacagaaaag gtaaggacga tgaagaagaa gataggtaca gcagatccaa cagcgccgga      1380
     atggttgaga ggtctttatc ggaatcatgg ccggagatga ggaatggaga aggaggagga      1440
     ccgaagatga ggaggagtaa cagcaatgtg agctggcgaa gctccggtgg aggatcggcg      1500
     aggaataaga gttcgaggta ttcgtccaaa gatggagaga acggaatgtt gaggttttat      1560
     ttgactccga tgaggagaag ctggaagacc agcggtggta gtggtggagg cggaggcggt      1620
     ggtggtggtg gtgggtggga gaagacggcg gctaaggcga atagtcacgg ccactctata      1680
     gcgaggaggg ttatgaggct gtattga                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page