(data stored in ACNUC13479 zone)

EMBL: CP002688.PE34

CP002688.PE34        Location/Qualifiers
FT   CDS_pept        complement(join(61257..62091,62166..62716,62818..63035,
FT                   63132..63240))
FT                   /codon_start=1
FT                   /gene="PTR5"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 5"
FT                   /gene_synonym="ATPTR5"
FT                   /gene_synonym="F7J8.160"
FT                   /gene_synonym="F7J8_160"
FT                   /gene_synonym="peptide transporter 5"
FT                   /gene_synonym="AtNPF8.2"
FT                   /gene_synonym="NPF8.2"
FT                   /gene_synonym="NRT1/ PTR family 8.2"
FT                   /locus_tag="AT5G01180"
FT                   /product="peptide transporter 5"
FT                   /note="peptide transporter 5 (PTR5); CONTAINS InterPro
FT                   DOMAIN/s: PTR2 family proton/oligopeptide symporter,
FT                   conserved site (InterPro:IPR018456), Oligopeptide
FT                   transporter (InterPro:IPR000109), Major facilitator
FT                   superfamily, general substrate transporter
FT                   (InterPro:IPR016196); BEST Arabidopsis thaliana protein
FT                   match is: peptide transporter 1 (TAIR:AT3G54140.1); Has
FT                   1807 Blast hits to 1807 proteins in 277 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFB8"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFB8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP862584.1,INSD:EL996193.1,INSD:EL294392.1,
FT                   INSD:ES069438.1,INSD:ES040631.1,INSD:ES176495.1,
FT                   INSD:AU236426.1,INSD:AU227341.1,INSD:ES053274.1,
FT                   INSD:AV565600.1,INSD:ES210068.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX830286.1,INSD:BT005728.1,INSD:BX829379.1,
FT                   INSD:AK228435.1"
FT                   /protein_id="AED90307.1"
FT                   /translation="MEDDKDIYTKDGTLDIHKKPANKNKTGTWKACRFILGTECCERLA
FT                   YYGMSTNLINYLEKQMNMENVSASKSVSNWSGTCYATPLIGAFIADAYLGRYWTIASFV
FT                   VIYIAGMTLLTISASVPGLTPTCSGETCHATAGQTAITFIALYLIALGTGGIKPCVSSF
FT                   GADQFDDTDEKEKESKSSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVAMA
FT                   IAVVFFFAGSNFYRLQKPGGSPLTRMLQVIVASCRKSKVKIPEDESLLYENQDAESSII
FT                   GSRKLEHTKILTFFDKAAVETESDNKGAAKSSSWKLCTVTQVEELKALIRLLPIWATGI
FT                   VFASVYSQMGTVFVLQGNTLDQHMGPNFKIPSASLSLFDTLSVLFWAPVYDKLIVPFAR
FT                   KYTGHERGFTQLQRIGIGLVISIFSMVSAGILEVARLNYVQTHNLYNEETIPMTIFWQV
FT                   PQYFLVGCAEVFTFIGQLEFFYDQAPDAMRSLCSALSLTAIAFGNYLSTFLVTLVTKVT
FT                   RSGGRPGWIAKNLNNGHLDYFFWLLAGLSFLNFLVYLWIAKWYTYKKTTGHAL"
     atggaagatg acaaggatat atacacaaaa gatggaactc ttgacattca caagaaacca        60
     gccaacaaga ataaaactgg aacctggaaa gcttgcagat tcattcttgg aactgagtgc       120
     tgtgaaagat tagcttacta tggaatgagt actaatctca tcaactatct cgagaaacaa       180
     atgaatatgg aaaacgtctc tgcttctaag agtgtcagta actggtctgg aacatgttac       240
     gctactcctt tgatcggtgc ttttatcgcc gatgcttatc tcggtcgata ctggaccatc       300
     gcttcctttg tcgtcatcta cattgccgga atgacgctat tgacgatatc agcttcggtt       360
     cctggtctaa caccaacctg cagcggagaa acctgtcacg caacagcggg tcaaaccgct       420
     attacattca tagcgcttta cttgatcgca ctcggaactg gagggatcaa gccttgtgtc       480
     tcttcctttg gtgctgatca gtttgatgat acagacgaaa aagagaaaga gtctaagagc       540
     tctttcttta actggttcta ctttgtgatc aacgttggtg caatgattgc ttcctctgtt       600
     ctcgtttgga ttcagatgaa tgttggttgg ggttggggtt taggtgttcc caccgtcgca       660
     atggctatag ccgtcgtgtt cttcttcgcc ggaagcaact tctacaggct gcagaaacca       720
     ggaggaagtc ctctcacaag aatgctgcaa gtcattgtgg cttcatgcag aaaatctaaa       780
     gtgaaaattc ctgaagatga atctcttctc tacgagaacc aagacgccga aagcagtatc       840
     ataggaagcc gcaagctcga acacaccaaa atattaacgt tctttgataa ggcagcagtg       900
     gaaacagaga gtgacaacaa aggagcagct aagtcgtctt catggaagct atgcacagtg       960
     acacaagtag aagagctcaa agcactgatc cgtctcttac cgatttgggc cacagggatt      1020
     gttttcgctt cggtttatag ccaaatgggg actgtgtttg tactacaagg caacacactg      1080
     gaccaacaca tgggacctaa cttcaaaatc ccttccgcat cactctcctt attcgatacg      1140
     cttagtgtcc tgttttgggc acctgtctac gacaagctaa ttgttccctt cgcccggaaa      1200
     tacacaggtc acgaacgcgg attcacacag cttcaacgga ttggaatcgg gcttgtaatc      1260
     tccatctttt ctatggtctc tgcgggaatc ctcgaggtcg caaggttaaa ctacgttcaa      1320
     acacacaatc tttacaatga agagactatc ccgatgacga ttttctggca agttccgcag      1380
     tattttttgg tgggttgcgc cgaggttttc acgtttatag gtcagcttga gttcttctat      1440
     gaccaagctc ctgatgctat gaggagtctc tgctcggctt tgtcgctcac cgcaattgca      1500
     tttgggaact atctgagcac atttctggtg acattggtca ctaaagtcac gagatcaggt      1560
     ggaagaccag gctggatcgc taagaacctc aacaatggtc atcttgatta cttcttttgg      1620
     ctattagctg gtctgagttt cttgaatttc ttggtctacc tttggattgc taaatggtac      1680
     acttacaaga aaacgaccgg gcatgcgctt tga                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page