(data stored in ACNUC13479 zone)

EMBL: CP002688.PE37

CP002688.PE37        Location/Qualifiers
FT   CDS_pept        join(77116..77576,77952..78294)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.180"
FT                   /gene_synonym="F7J8_180"
FT                   /locus_tag="AT5G01200"
FT                   /product="Duplicated homeodomain-like superfamily protein"
FT                   /note="Duplicated homeodomain-like superfamily protein;
FT                   CONTAINS InterPro DOMAIN/s: Molecular chaperone, heat shock
FT                   protein, Hsp40, DnaJ (InterPro:IPR015609), SANT, eukarya
FT                   (InterPro:IPR017884), Myb-like DNA-binding domain, SHAQKYF
FT                   class (InterPro:IPR006447), SANT, DNA-binding
FT                   (InterPro:IPR001005), Myb, DNA-binding
FT                   (InterPro:IPR014778), Homeodomain-like
FT                   (InterPro:IPR009057), HTH transcriptional regulator,
FT                   Myb-type, DNA-binding (InterPro:IPR017930); BEST
FT                   Arabidopsis thaliana protein match is: Duplicated
FT                   homeodomain-like superfamily protein (TAIR:AT2G38090.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01200"
FT                   /db_xref="GOA:Q9LFB6"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV562130.1,INSD:ES169273.1,INSD:AV559299.1,
FT                   INSD:DR749785.1,INSD:DR749786.1,INSD:ES056308.1,
FT                   INSD:AV441418.1,INSD:EL991022.1,INSD:AA597360.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY519530.1"
FT                   /protein_id="AED90309.1"
FT                   /translation="MSSSTMYRGVNMFSPANTNWIFQEVREATWTAEENKRFEKALAYL
FT                   DDKDNLESWSKIADLIPGKTVADVIKRYKELEDDVSDIEAGLIPIPGYGGDASSAANSD
FT                   YFFGLENSSYGYDYVVGGKRSSPAMTDCFRSPMPEKERKKGVPWTEDEHLRFLMGLKKY
FT                   GKGDWRNIAKSFVTTRTPTQVASHAQKYFLRQLTDGKDKRRSSIHDITTVNIPDADASA
FT                   TATTADVALSPTPANSFDVFLQPNPHYSFASASASSYYNAFPQWS"
     atgtcatcgt cgacgatgta cagaggagtt aatatgtttt caccggcaaa cacaaactgg        60
     atttttcaag aagtcagaga agccacgtgg acggcggagg agaacaaacg gttcgagaaa       120
     gctctcgctt atctggacga caaagacaat cttgagagct ggtccaagat cgcagatttg       180
     attcccggca aaacagtagc tgacgtcatt aaacgataca aggagctaga ggatgatgtc       240
     agcgacatcg aagccggact tatccccatt ccgggatacg gcggcgacgc ctcctccgct       300
     gcaaacagtg actatttctt tggtctagaa aactccagct acggttatga ttacgtcgtt       360
     ggaggaaaga ggagttcgcc ggcgatgact gattgtttta ggtctccgat gccggaaaag       420
     gagaggaaga aaggagttcc gtggaccgag gacgaacacc tacgatttct gatgggtttg       480
     aagaaatatg gaaaaggaga ttggagaaac atagcaaaaa gctttgtgac gactcgaacg       540
     ccgacgcaag tcgcttcaca cgctcagaaa tattttcttc gacaactcac agatggtaaa       600
     gacaaaagac gatcaagtat tcacgatatc accactgtta acatccctga cgcagacgca       660
     tccgcaaccg ccacgaccgc tgacgtagca ctctctccta ctccagccaa ttcttttgac       720
     gttttccttc agccaaatcc tcattacagt ttcgcgtctg cgtctgcgtc tagctattat       780
     aatgcgtttc cgcagtggag ttaa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page