(data stored in ACNUC13479 zone)

EMBL: CP002688.PE38

CP002688.PE38        Location/Qualifiers
FT   CDS_pept        84554..85981
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.190"
FT                   /gene_synonym="F7J8_190"
FT                   /locus_tag="AT5G01210"
FT                   /product="HXXXD-type acyl-transferase family protein"
FT                   /note="HXXXD-type acyl-transferase family protein;
FT                   FUNCTIONS IN: transferase activity, transferring acyl
FT                   groups other than amino-acyl groups, transferase activity;
FT                   INVOLVED IN: biological_process unknown; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 22 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Transferase (InterPro:IPR003480); BEST
FT                   Arabidopsis thaliana protein match is: HXXXD-type
FT                   acyl-transferase family protein (TAIR:AT2G39980.1); Has
FT                   1807 Blast hits to 1807 proteins in 277 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01210"
FT                   /db_xref="GOA:Q9LFB5"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV802611.1,INSD:EH861324.1,INSD:BP846622.1,
FT                   INSD:EL142230.1,INSD:BP810310.1,INSD:EL286263.1,
FT                   INSD:EL180315.1,INSD:EL026361.1,INSD:EG446944.1,
FT                   INSD:BP616221.1,INSD:EL203761.1,INSD:EL289267.1,
FT                   INSD:AV549757.1,INSD:BP597645.1,INSD:BE038811.1,
FT                   INSD:EH851838.1,INSD:EL029540.1,INSD:EH843524.1,
FT                   INSD:EG520327.1,INSD:EH880521.1,INSD:DR277441.1,
FT                   INSD:ES083467.1,INSD:EL120956.1,INSD:EL044455.1,
FT                   INSD:EL061977.1,INSD:AV815496.1,INSD:BP576300.1,
FT                   INSD:EH940334.1,INSD:EL038872.1,INSD:BP585479.1,
FT                   INSD:AV441577.1,INSD:AU231413.1,INSD:BP810930.1,
FT                   INSD:EL119588.1,INSD:EH845182.1,INSD:EH931147.1,
FT                   INSD:EG496360.1,INSD:EL023629.1,INSD:AV831217.1,
FT                   INSD:DR277439.1,INSD:EH973394.1,INSD:CB257290.1,
FT                   INSD:CF651460.1,INSD:CB185631.1,INSD:AV439866.1,
FT                   INSD:EL161364.1,INSD:AV525248.1,INSD:BP617184.1,
FT                   INSD:EL000466.1,INSD:CF651461.1,INSD:BP810889.1,
FT                   INSD:AI992711.1,INSD:EL251207.1,INSD:R64951.1,
FT                   INSD:EL275218.1,INSD:EL108295.1,INSD:DR277440.1,
FT                   INSD:EL010267.1,INSD:AV534126.1,INSD:EL216601.1,
FT                   INSD:EH798532.1,INSD:EH873268.1,INSD:Z34199.1,
FT                   INSD:EL057253.1,INSD:EL044255.1,INSD:EG520326.1,
FT                   INSD:AV814945.1,INSD:ES016673.1,INSD:EH959985.1,
FT                   INSD:EL203084.1,INSD:BP620245.1,INSD:EH864522.1,
FT                   INSD:AV518442.1,INSD:EL328936.1,INSD:AV539490.1,
FT                   INSD:EL230105.1,INSD:EL285901.1,INSD:EH830017.1,
FT                   INSD:EL288604.1,INSD:AV525044.1,INSD:BP853597.1,
FT                   INSD:AV548595.1,INSD:BP616519.1,INSD:EL056563.1,
FT                   INSD:EL341663.1,INSD:AV518287.1,INSD:EL125351.1,
FT                   INSD:EH873745.1,INSD:ES126423.1,INSD:DR277444.1,
FT                   INSD:N95993.1,INSD:BP572016.1,INSD:EL078817.1,
FT                   INSD:EL228634.1,INSD:EH945221.1,INSD:ES123246.1,
FT                   INSD:EH835220.1,INSD:EH836812.1,INSD:BP807445.1,
FT                   INSD:EL313180.1,INSD:EL260835.1,INSD:BP621142.1,
FT                   INSD:BP586074.1,INSD:AV828731.1,INSD:EH982768.1,
FT                   INSD:BP671901.1,INSD:EL335605.1,INSD:BP822633.1,
FT                   INSD:BP569061.1,INSD:EH970548.1,INSD:DR277445.1,
FT                   INSD:EL233748.1,INSD:T41686.1,INSD:EH833701.1,
FT                   INSD:DR277443.1,INSD:DR277442.1,INSD:EL044308.1,
FT                   INSD:EL004625.1,INSD:BP602937.1,INSD:EL094217.1,
FT                   INSD:AV803113.1,INSD:ES061240.1,INSD:W43665.1,
FT                   INSD:Z34616.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX830368.1,INSD:AY090321.1,INSD:BX832518.1,
FT                   INSD:AK227159.1,INSD:AY056412.1,INSD:BX830266.1"
FT                   /protein_id="AED90310.1"
FT                   /translation="MPSCSVTEISKCIVYPEKKSTVSDLRLSVSDLPMLSCHYIQKGVL
FT                   LTSPPPSFSFDDLVSSLRRSLSSTLSLFPALAGRFSTTPAGHISIVCNDAGVDFVAASA
FT                   KHVKLSDVLLPGEDVPLLFREFFVFERLVSYNGHHKPLAAVQVTELHDGVFIGCTVNHS
FT                   VTDGTSFWHFFNTFADVTSGACKIKHLPDFSRHTVFDSPVVLPVPPGGPRVTFDADQPL
FT                   RERIFHFSREAITKLKQRTNNRVNGIETAVNDGRKCNGEINGKITTVLDSFLNNKKSYD
FT                   RTAEISSFQSLSAQLWRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSI
FT                   PTLASAGDLLSKDLRWSAEQLHRNVVAHDDATVRRGIAAWESDPRLFPLGNPDGASITM
FT                   GSSPRFPMYDNDFGWGKPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMTGI
FT                   ENDAEFMQYVSEVTYDC"
     atgccttctt gttcggtaac tgaaatttca aaatgtatcg tctatccgga gaagaagtcc        60
     accgtctccg atctccgtct ctccgtctcc gacctcccta tgctctcatg tcattacatt       120
     caaaaaggcg tcctcctcac cagccctcct ccttccttct ccttcgacga ccttgtctcc       180
     tctctccgcc gttctctctc ctccactctt tccctcttcc ctgctttagc cggccgtttc       240
     tccaccactc ccgccggtca catttccatt gtctgcaacg acgccggagt tgatttcgtc       300
     gccgcttccg ctaaacacgt caaactctct gatgttctct taccaggtga agacgttcct       360
     ctgcttttcc gtgagttttt cgtcttcgag cgtctcgtta gttacaacgg tcatcataag       420
     cctctcgccg ccgttcaagt gacggagctc cacgacggtg tcttcatcgg atgtaccgtg       480
     aatcattccg ttactgacgg aacttccttc tggcacttct tcaacacctt tgctgacgtc       540
     actagcggtg cttgtaagat caaacacctt ccagatttct cccgccacac cgtcttcgat       600
     tctccggtcg ttcttccagt ccctcccggt ggtccacgtg tcactttcga cgccgaccaa       660
     cctctacggg agagaatttt tcatttcagc agagaggcga ttaccaaact gaaacagagg       720
     acgaataaca gagttaacgg aattgagact gccgttaacg atggaaggaa atgtaacgga       780
     gagattaacg gaaaaataac aaccgttttg gatagttttt tgaataataa gaagagttat       840
     gatcggacgg ctgagatttc atcgttccaa tctctcagcg ctcagctatg gcgatccgtt       900
     acacgagcga ggaatctcga tccgagcaag acgacgacgt ttcgaatggc ggttaattgc       960
     cggcaccggc ttgagccgaa gatggatccg tactacttcg gaaacgcgat acagagcata      1020
     ccgacgttgg cgtctgcggg agatctgcta agcaaagatc tcaggtggtc cgccgaacag      1080
     ttacacagga acgtggtggc gcacgacgac gcgacggtcc gccgtggaat cgccgcttgg      1140
     gaaagcgatc cgaggctgtt tcctctcgga aatccagatg gagcttcgat cacgatgggg      1200
     agctcgccga gattcccaat gtacgacaat gatttcggat ggggaaaacc gttagctgtg      1260
     agaagcggcg gagcgaataa attcgacggg aagatctcgg cgtttcccgg tagagaagga      1320
     aacggaagcg tggatctgga agtagttctg gcgccggaga ctatgactgg gattgagaac      1380
     gatgctgagt ttatgcaata cgtatcagaa gtcacttacg attgttga                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page