(data stored in ACNUC13479 zone)

EMBL: CP002688.PE41

CP002688.PE41        Location/Qualifiers
FT   CDS_pept        91920..92324
FT                   /codon_start=1
FT                   /locus_tag="AT5G01225"
FT                   /product="josephin-like protein"
FT                   /note="unknown protein; BEST Arabidopsis thaliana protein
FT                   match is: unknown protein (TAIR:AT3G09032.1); Has 30201
FT                   Blast hits to 17322 proteins in 780 species: Archae - 12;
FT                   Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants -
FT                   5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01225"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01225.1"
FT                   /db_xref="GOA:Q3E9N0"
FT                   /db_xref="UniProtKB/TrEMBL:Q3E9N0"
FT                   /protein_id="AED90312.1"
FT                   /translation="MSRRASKRVRFSPDPEANDELIFPTHSSSRHGRRRVVVGIFSFSF
FT                   SDSPATTKRLLRSIGDRVGKTFRYISFGRMNTKTTPSSSSNVSSSLYLMKSKSLNGSES
FT                   HRAEAIEDCIEFLNSCSSLSRSNSISTWSR"
     atgtctcgaa gagcatccaa aagagtacgc tttagtccgg acccagaagc aaacgacgaa        60
     ctgatcttcc caacacacag ctcatcacgg catggtcgca ggagggtcgt tgttggaata       120
     ttcagtttca gcttcagtga ctcgccggca acgacgaaga gattactccg cagtattgga       180
     gacagagttg gcaaaacgtt tcgttatata tcattcggca ggatgaacac caaaacgaca       240
     ccgtcatctt ccagtaacgt ttcttcgtct ctttatttga tgaagtcaaa gtctctaaac       300
     ggatcagagt ctcaccgtgc agaagccatt gaggactgca ttgagttctt aaactcttgc       360
     tcttctttgt cgagatcaaa ctcgatctct acctggtctc gctaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page