(data stored in ACNUC13479 zone)

EMBL: CP002688.PE42

CP002688.PE42        Location/Qualifiers
FT   CDS_pept        complement(join(92789..93009,93289..93396,93521..93584,
FT                   93734..93826,93949..94001,94086..94146,94264..94372,
FT                   94482..94531,94948..94997,95155..95248,95354..95380))
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.210"
FT                   /gene_synonym="F7J8_210"
FT                   /locus_tag="AT5G01230"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /note="S-adenosyl-L-methionine-dependent methyltransferases
FT                   superfamily protein; FUNCTIONS IN: methyltransferase
FT                   activity, nucleic acid binding; INVOLVED IN: methylation,
FT                   rRNA methylation; LOCATED IN: cellular_component unknown;
FT                   EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Ribosomal RNA
FT                   methyltransferase J (InterPro:IPR015507), Ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ (InterPro:IPR002877); BEST
FT                   Arabidopsis thaliana protein match is: FtsJ-like
FT                   methyltransferase family protein (TAIR:AT4G25730.1); Has
FT                   5711 Blast hits to 5669 proteins in 1418 species: Archae -
FT                   154; Bacteria - 2315; Metazoa - 596; Fungi - 413; Plants -
FT                   124; Viruses - 65; Other Eukaryotes - 2044 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01230"
FT                   /db_xref="GOA:Q8GUN8"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR028590"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GUN8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR376531.1,INSD:DR340118.1,INSD:ES195894.1,
FT                   INSD:DR340117.1,INSD:AV782172.1,INSD:ES006860.1,
FT                   INSD:ES112689.1,INSD:ES077788.1,INSD:BP864121.1,
FT                   INSD:ES093155.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT002330.1"
FT                   /protein_id="AED90314.1"
FT                   /translation="MGKASRDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIFEGVKRV
FT                   VDLCAAPGSWSQVLSRQLYLPAKSSAESKDGDLPLIVAIDLQPMAPIEGVIQVQGDITN
FT                   ARTAEVVIRHFDGCKADLVVCDGAPDVTGLHDMDEFVQSQLILAGLTIVTHILKEGGKF
FT                   IAKIFRGKDTSLLYCQLKLFFPTVTFAKPKSSRNSSIEAFAVCENYSPPEGFNPRDLHR
FT                   LLEKVGSPSGGSDLDCSSGWLEGPNKVYIPFLACGDLTGYDSDRSYPLPREADGSSYQS
FT                   LDPIQPPIAPPYKRALELKKASAQSFNS"
     atgggaaaag cttctcgaga caaaagggat atctattatc gtaaagctaa agaagaagga        60
     tggcgtgcaa gaagtgcttt taagcttctt cagattgatg aagaatttaa tatttttgaa       120
     ggtgtgaaga gggtcgtaga tttatgtgct gcacctggta gctggagtca ggtcttgagt       180
     cgtcaattat atcttcctgc aaagtcctca gctgagtcaa aagatgggga tcttcctctt       240
     atagtagcca tcgatttgca gcctatggct ccaattgaag gtgtcatcca ggttcaaggg       300
     gacataacta atgctcggac tgctgaagtg gtcattagac actttgacgg ctgcaaagcg       360
     gacctggttg tctgtgatgg tgctccagat gttactggtt tgcatgacat ggatgaattt       420
     gtccagtccc aactcatact agcaggatta acgattgtaa ctcatattct taaagaaggt       480
     ggaaaattta ttgcaaagat attccgtgga aaagatacaa gtctcttgta ctgtcaactg       540
     aaattgtttt tcccaaccgt aacttttgcg aaaccgaaaa gcagccgcaa ttcaagtata       600
     gaggcttttg cagtctgcga gaattactct ccgccagaag gatttaaccc gagagatctg       660
     catcgtctct tggagaaagt cggaagccct tcaggtggaa gcgatctcga ttgcagtagt       720
     ggttggcttg aaggacccaa caaagtttat ataccattct tggcatgtgg tgacttaacc       780
     ggttatgact cagaccggtc ttacccactc cctagagaag cagatggatc atcataccag       840
     agtttggacc cgattcaacc tccgatcgca ccgccttata aacgagctct tgagctcaag       900
     aaagcttcag cacaaagctt caactcttga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page