(data stored in ACNUC13479 zone)

EMBL: CP002688.PE45

CP002688.PE45        Location/Qualifiers
FT   CDS_pept        join(98663..98803,98931..99043,99176..99359,99441..99538,
FT                   100118..100325,100634..100891,101269..101493)
FT                   /codon_start=1
FT                   /gene="LAX1"
FT                   /gene_synonym="F7J8.220"
FT                   /gene_synonym="F7J8_220"
FT                   /gene_synonym="like AUXIN RESISTANT 1"
FT                   /locus_tag="AT5G01240"
FT                   /product="like AUXIN RESISTANT 1"
FT                   /note="like AUXIN RESISTANT 1 (LAX1); FUNCTIONS IN:
FT                   transporter activity; INVOLVED IN: amino acid transport,
FT                   root cap development; LOCATED IN: endomembrane system,
FT                   membrane; EXPRESSED IN: 20 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Amino
FT                   acid transporter, transmembrane (InterPro:IPR013057); BEST
FT                   Arabidopsis thaliana protein match is: Transmembrane amino
FT                   acid transporter family protein (TAIR:AT2G38120.1); Has
FT                   35333 Blast hits to 34131 proteins in 2444 species: Archae
FT                   - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants
FT                   - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01240"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01240.2"
FT                   /db_xref="GOA:F4K7Z8"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7Z8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP787325.1,INSD:AV786500.1,INSD:BP780173.1,
FT                   INSD:EH860636.1,INSD:EH878879.1,INSD:EL083575.1,
FT                   INSD:BP664740.1,INSD:BP591839.1,INSD:BP654245.1,
FT                   INSD:BP664825.1,INSD:EH972697.1,INSD:BP647266.1,
FT                   INSD:AV790258.1,INSD:EL063314.1,INSD:EL022068.1,
FT                   INSD:EL240342.1,INSD:EL283994.1,INSD:EH835424.1,
FT                   INSD:CF773448.1,INSD:EH846141.1,INSD:EL072648.1,
FT                   INSD:BP779699.1,INSD:EL163876.1,INSD:EL215878.1,
FT                   INSD:EL170376.1,INSD:BP615918.1,INSD:EH984785.1,
FT                   INSD:EL187318.1,INSD:BP644678.1,INSD:BP587397.1,
FT                   INSD:BP665586.1,INSD:EL165075.1,INSD:EH804336.1,
FT                   INSD:BP638154.1,INSD:EL155882.1,INSD:EL014164.1,
FT                   INSD:BP659331.1,INSD:EH984893.1,INSD:BP792310.1,
FT                   INSD:DR363559.1,INSD:AV781921.1,INSD:EG493607.1,
FT                   INSD:EL106371.1,INSD:EH938681.1,INSD:EL150053.1,
FT                   INSD:EL134083.1,INSD:EL078195.1,INSD:EH922564.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX830786.1,INSD:BX830611.1"
FT                   /protein_id="AED90316.1"
FT                   /translation="MLSGILLQIFYGLMGSWTAYLISVLYVEYRARMEKQEAKSFKNHV
FT                   IQWFEVLDGLLGPYWKAAGLAFNCTFLLFGSVIQLIACASNIYYINDRLDKRTWTYIFG
FT                   ACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLTIASFLHGQAEGVTHSGPTKLVLYFT
FT                   GATNILYTFGGHAVTVEIMHAMWKPRKFKSIYLMATLYVFTLTLPSASAVYWAFGDQLL
FT                   NHSNAFSLLPKTRFRDTAVILMLIHQFITFGFACTPLYFVWEKAIGMHHTKSLCLRALV
FT                   RLPVVVPIWFLAIIFPFFGPINSAVGALLVTFTVYIIPALAHMLTYRTASARRNAAEKP
FT                   PFFIPSWAGVYVINAFIVVWVLVLGFGFGGWASMTNFIRQIDTFGLFAKCYQCKPPPAP
FT                   IAAGAHHRR"
     atgttatcag gaatattgct tcaaatattc tatgggttaa tgggatcttg gactgcttat        60
     ctcatcagtg ttctttacgt cgagtatcgt gcccgtatgg agaaacaaga agccaaatcc       120
     ttcaaaaacc acgttattca atggtttgaa gtgcttgatg ggctgctggg tccgtactgg       180
     aaagcagcgg ggctcgcatt taattgcacc ttcttgttat tcggatcagt catccagctc       240
     attgcttgtg ctagcaatat atattacata aacgataggt tagacaagag gacatggact       300
     tatatatttg gggcttgctg tgccacgacc gttttcatac catctttcca caattaccgt       360
     atttggtctt tcctcggcct tggcatgacc acctacaccg cttggtacct caccatcgcc       420
     tcttttctcc atggtcaggc ggagggtgtg acacattccg gtccaaccaa gcttgtgttg       480
     tactttaccg gagccaccaa catcctctat accttcggtg gacacgctgt gaccgtggaa       540
     ataatgcatg cgatgtggaa accaaggaag tttaagagca tctacttgat ggcaactctg       600
     tacgtcttca cattaacgct tccgtcagcc tccgccgtct actgggcttt cggcgaccaa       660
     cttctcaacc actcaaacgc tttctctctc ctccctaaaa cgcgtttccg tgacaccgcc       720
     gttatcctca tgctcatcca tcagtttata acgttcgggt ttgcgtgtac accattgtac       780
     ttcgtatggg aaaaagcgat cggaatgcac cacacaaaga gcttatgtct aagagcgctg       840
     gtgaggctac cggtggtggt tccgatatgg tttttggcaa tcatctttcc ctttttcggg       900
     ccaataaact cggcagttgg agccttactt gttaccttca ccgtctatat catccctgcc       960
     ttagcccaca tgctcacgta ccgcaccgcc tctgcccgcc ggaacgcggc ggagaaacca      1020
     ccgtttttta tccctagctg ggctggagtt tacgtgataa acgctttcat agtggtttgg      1080
     gtcctagttc tcgggttcgg gtttggcgga tgggccagta tgaccaactt catcaggcaa      1140
     attgatactt ttggcctctt tgccaaatgc taccaatgca aaccacctcc agctccgatc      1200
     gccgccggag ctcaccaccg ccgttag                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page