(data stored in ACNUC13479 zone)

EMBL: CP002688.PE46

CP002688.PE46        Location/Qualifiers
FT   CDS_pept        complement(102370..103593)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.230"
FT                   /gene_synonym="F7J8_230"
FT                   /locus_tag="AT5G01250"
FT                   /product="alpha 1,4-glycosyltransferase family protein"
FT                   /note="alpha 1,4-glycosyltransferase family protein;
FT                   FUNCTIONS IN: transferase activity, transferring glycosyl
FT                   groups, transferase activity; INVOLVED IN:
FT                   biological_process unknown; LOCATED IN: Golgi stack;
FT                   CONTAINS InterPro DOMAIN/s: Alpha 1,4-glycosyltransferase
FT                   conserved region (InterPro:IPR007652), Glycosyltransferase,
FT                   DXD sugar-binding region (InterPro:IPR007577); BEST
FT                   Arabidopsis thaliana protein match is: alpha
FT                   1,4-glycosyltransferase family protein (TAIR:AT3G09020.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01250"
FT                   /db_xref="GOA:Q9LFB1"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR007652"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AA721858.1,INSD:AU237937.1,INSD:AU229051.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832384.1,INSD:BT015324.1,INSD:BX832585.1,
FT                   INSD:AK229418.1"
FT                   /protein_id="AED90317.1"
FT                   /translation="MDRHDIEKRFTVVIDNRRLNQSGSSSLFTAFAISFVTLIVVTTFT
FT                   LISNFSMQPHRDFSGVKIEIKRVIPHLPLSSEREGERSDLLKQQTQVNEKLQVIEVFSG
FT                   DNLSDKFQKRVNEFVGDGCEVNFVMTWISPADFFGNREVLAIESVFKSHPYGCLMILSA
FT                   TMDSPQGYATLKPFIDRGYKVLAVTPDLPFLLKGTAGELWLDEIKSGKRDPGKISLAQN
FT                   LSNLMRLAYLYKYGGVYLDTDMIVLKSFKGLRNVIGAQTLDPSSTNWTRLNNAVLIFDK
FT                   NHPLLLKFMEEFAKTFNGNIWGYNGPYLVSRVARAVEGSSGYNFTVMRPSVFYSVNWLE
FT                   IKKLFKVPKTEKDSKWVKTKLLHMQRNGYGLHLWNKFSRKYEIEQGSAMWKLVSEHCII
FT                   CEISSVSS"
     atggatcgtc atgatataga aaagagattc acggtggtga ttgataacag acgactaaac        60
     caatcaggat catcatcact tttcaccgcc ttcgctatca gctttgtaac tctgatcgtg       120
     gttaccacgt ttactctaat ttctaatttc tcgatgcaac cgcatagaga tttctcagga       180
     gtgaagatag agatcaagag agtgattcca cacttacctc tgagttctga gagagaaggt       240
     gaaagaagtg atctgctcaa acaacagaca caagtaaacg agaagctcca agttatcgaa       300
     gttttcagtg gagataactt gtctgacaag tttcaaaaga gggtaaatga gtttgtcggt       360
     gatggatgcg aagtcaactt cgtcatgaca tggatatcac cagcagattt ctttggcaat       420
     agagaggttt tagctattga aagtgtcttt aagtctcatc cgtatggttg cttgatgatc       480
     ttatccgcaa ccatggattc tcctcaaggt tatgcaactt tgaagccgtt tattgatcgt       540
     ggttacaaag ttcttgcagt cacaccagat ttgccttttc tgctcaaagg aaccgcggga       600
     gagttgtggc tcgacgaaat aaagagcggt aaaagagatc ccggaaagat ttctttagct       660
     cagaatctct caaatctcat gaggcttgct tacttgtaca aatatggagg tgtgtactta       720
     gacacagaca tgattgttct aaaaagcttc aaaggtctga gaaacgtgat tggtgcacaa       780
     acacttgatc cttcatcaac gaattggaca agactaaaca acgcggtact aatattcgac       840
     aagaaccatc ctctgttact caaattcatg gaagagttcg ctaaaacttt caacggaaac       900
     atatggggat acaacggacc ataccttgtt tcacgagtgg ctagagctgt agaaggatca       960
     agtggctata acttcaccgt catgcgacca tctgtgttct attcggtaaa ctggctcgag      1020
     attaagaagt tgttcaaagt gcctaaaaca gagaaagatt cgaaatgggt caaaaccaag      1080
     cttcttcata tgcagaggaa tggttatggt ttgcatctgt ggaataagtt tagcaggaaa      1140
     tacgaaattg aacaaggaag tgccatgtgg aaactggttt cagagcattg cataatctgt      1200
     gaaattagtt ctgtatcatc atag                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page