(data stored in ACNUC13479 zone)

EMBL: CP002688.PE49

CP002688.PE49        Location/Qualifiers
FT   CDS_pept        join(105367..105582,105697..105888,105976..106488)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.240"
FT                   /gene_synonym="F7J8_240"
FT                   /locus_tag="AT5G01260"
FT                   /product="Carbohydrate-binding-like fold"
FT                   /note="Carbohydrate-binding-like fold; FUNCTIONS IN:
FT                   carbohydrate binding, catalytic activity; INVOLVED IN:
FT                   carbohydrate metabolic process; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 21 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Immunoglobulin-like fold
FT                   (InterPro:IPR013783), Carbohydrate-binding-like fold
FT                   (InterPro:IPR013784), Glycoside hydrolase,
FT                   carbohydrate-binding (InterPro:IPR002044); BEST Arabidopsis
FT                   thaliana protein match is: catalytics;carbohydrate
FT                   kinases;phosphoglucan, water dikinases (TAIR:AT5G26570.1);
FT                   Has 30201 Blast hits to 17322 proteins in 780 species:
FT                   Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi -
FT                   3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01260"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01260.1"
FT                   /db_xref="GOA:Q93ZD1"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:Q93ZD1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL320757.1,INSD:EH991409.1,INSD:CB261918.1,
FT                   INSD:AV829512.1,INSD:AV806583.1,INSD:ES174875.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY143857.1,INSD:AY057624.1"
FT                   /protein_id="AED90319.1"
FT                   /translation="MIGIGRTLTSSSPSKIILEDLPPGIYRYGTEIFTSVPRKTFHHIK
FT                   FLRLDSAQSSRILKPVPLRSSSIKDSQVNVEDEEIEASNKTVRVRFQLRKECVFGEHFF
FT                   IVGDDPVFGGLWDPETALPLNWSDGNVWTVDLDLPVGRLVEFKLLLKAQTGEILWQPGP
FT                   NRALETWETNKTIRICEDWDNADLQMMIEEDFVPYTNISSIGSEDEDEVLGSVQQNSSV
FT                   VAVENAGYVSDESAQNSSFSIQSEKTMEPSNGALTAREVIKEAMFTEEESPVLVPGLIP
FT                   LSDLDNEQVEVINEGKAETFPEVIT"
     atgattggca ttggaagaac cctaacttct tcttctccat ctaagatcat tctcgaagat        60
     cttcctcctg gaatttatcg ctatggaaca gagatattca cttccgttcc caggaaaacg       120
     ttccatcaca tcaagttttt gcgtttggat tctgctcaga gcagcaggat tcttaagccg       180
     gtcccgcttc gttcttcgtc gattaaggat tcgcaggtaa acgtagaaga tgaagaaatc       240
     gaagcttcta acaaaacagt tcgtgtaagg ttccagttgc ggaaagaatg tgtctttggg       300
     gaacattttt tcattgttgg tgatgatcct gtgttcggtg gcctttggga tccagaaact       360
     gccttaccac tgaactggtc tgatggcaat gtttggactg tagatttgga tttgcctgtt       420
     ggaagattgg ttgaatttaa gcttttattg aaggcacaga caggggagat tttgtggcaa       480
     ccaggtccaa accgggctct tgaaacctgg gaaactaaca aaactatcag aatatgtgaa       540
     gactgggata atgctgatct tcaaatgatg attgaggaag attttgtgcc ttacaccaat       600
     atttcgtcga tcggttcaga agatgaggat gaagtgcttg gtagtgtaca acaaaactct       660
     tcagtagtag ctgtagagaa tgcaggatac gtgagtgatg agtctgccca gaattcgagt       720
     ttcagtatcc aaagtgagaa aactatggaa ccttcgaatg gagctttgac tgctcgggag       780
     gtgatcaaag aagccatgtt tactgaggaa gaaagtccag ttttggttcc tggattgatt       840
     cctctgtctg acttggataa tgaacaagtg gaagttatta atgaaggtaa agcagaaacg       900
     ttcccggagg taataacctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page