(data stored in ACNUC13479 zone)

EMBL: CP002688.PE52

CP002688.PE52        Location/Qualifiers
FT   CDS_pept        complement(join(114185..114373,114465..115487,
FT                   115604..115691,116155..116266,116344..116386))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.1"
FT                   /gene_synonym="BASIC PROLINE-RICH PROTEIN3"
FT                   /gene_synonym="BPP3"
FT                   /locus_tag="AT5G01280"
FT                   /product="GPI-anchored protein"
FT                   /note="BEST Arabidopsis thaliana protein match is:
FT                   proline-rich family protein (TAIR:AT3G09000.1); Has 1807
FT                   Blast hits to 1807 proteins in 277 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01280"
FT                   /db_xref="UniProtKB/TrEMBL:F4K804"
FT                   /inference="similar to RNA sequence, EST:INSD:T12964.1"
FT                   /protein_id="AED90322.2"
FT                   /translation="MRRCEKRHRPTLLMESDNTSSTTAMSSQQYPVRRTAGENLLYSDG
FT                   EKSDYEWLVTPPGSPSRNVTNHLNAPDDNLMTLISRLENYSKEESEHQTTSLHSSSSVS
FT                   GIRRPSSSSSSRSTSRPPTPTRKSKTPAKRPSTPTSRATSTTTRATLTSSSTTSSTRSW
FT                   SRPSSSSGTGTSRVTLTAARATRPTTSTDQQTTGSATSTRSNNRPMSAPNSKPGSRSST
FT                   PTRRPSTPNGSSTVLRSKPTKPLSKPALSLEASPIVRSRPWEPYEMPGFSVEAPSNLRT
FT                   TLPDRPQTASSSRTRAFDASSSSRSASTERDVAKRQSCSPSRSRAPNGNVNGAVPSLRG
FT                   QRAKTNNDDGRLISHAAKGNQKVEKVVNMRKLATPRLTESGSRRLGGGGGDSSAGKSSS
FT                   GSGGFGFGRNLSKSSIDMALRHMDVRKGSMAGNFRHSVTKAPATSVYSVRSCRNRPVSS
FT                   SRSSESSVNILCLDGSDDNLSDMSCS"
     atgcgtcgtt gcgagaaacg tcaccgacct acgcttttaa tggaatctga taatactagt        60
     agtacgacgg cgatgtcgtc tcaacaatac cctgtccgga gaactgccgg ggagaactta       120
     ttgtactccg atggcgagaa gtccgattac gaatggctgg tcacgccacc aggctcaccg       180
     agtagaaacg taacgaacca cctcaacgca cccgatgata acctgatgac tcttatatct       240
     cggttagaga actatagcaa agaagagtcc gagcaccaaa cgacgtcgtt acacagttcc       300
     tcctctgttt ctggaatcag aagaccatcg tcctctagta gctcaagatc aacgagtaga       360
     cctcccacgc caaccagaaa gtctaaaact ccagccaaaa ggccatcaac gccgacctca       420
     cgtgccacct caacaactac acgtgcgaca ttaacctcgt cctctactac tagctcaaca       480
     agatcatgga gcagaccttc ctctagctcc ggaactggaa cctcacgtgt taccttaacc       540
     gctgcacgtg caaccaggcc caccacctca acagaccaac aaactaccgg ttcagccacc       600
     tctactcgat ccaataacag gccgatgtcg gctcctaatt caaaaccggg atcgaggtca       660
     agtactccaa ctcgccgtcc atcaactccg aacggttcat cgactgtact gagaagtaaa       720
     ccaactaagc ctttgagtaa accggctctg tctttagaag cttctccgat cgtgagatca       780
     aggccatggg aaccttacga gatgcctgga ttctcagtag aagcgccatc gaatctcaga       840
     actacgttac cagataggcc acaaaccgct tcaagtagca gaaccagagc ctttgatgcg       900
     tcaagtagtt caagatcagc gtccacagaa cgcgatgttg caaagaggca atcgtgttcg       960
     ccttctagaa gccgagctcc taatggaaac gtaaatggtg ctgttccttc gttacgtgga      1020
     caacgagcaa agactaacaa cgatgatggt agattgataa gtcatgcggc taaggggaat      1080
     caaaaggtcg agaaagttgt gaatatgaga aaacttgcta caccgcgact gacagaaagc      1140
     ggcagtcgac gacttggtgg aggtggcgga gactcctccg ctgggaagtc gagctctgga      1200
     tctggtggtt ttgggtttgg tagaaaccta tctaaaagct ccatcgacat ggccttgaga      1260
     cacatggatg ttagaaaagg aagcatggcg gggaatttcc gacattcagt gacgaaagca      1320
     ccggcgactt cggtgtacag tgtgagatca tgtcgaaacc ggccggtgag cagcagccga      1380
     agctcggaat caagtgtcaa cattttgtgc ttagacggta gcgacgataa tctcagcgac      1440
     atgagttgct cttaa                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page