(data stored in ACNUC13479 zone)

EMBL: CP002688.PE54

CP002688.PE54        Location/Qualifiers
FT   CDS_pept        complement(join(114456..115487,115604..115691,
FT                   116155..116237))
FT                   /codon_start=1
FT                   /gene_synonym="BASIC PROLINE-RICH PROTEIN3"
FT                   /gene_synonym="BPP3"
FT                   /gene_synonym="T10O8.1"
FT                   /locus_tag="AT5G01280"
FT                   /product="GPI-anchored protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B9S1"
FT                   /protein_id="ANM68342.1"
FT                   /translation="MSSQQYPVRRTAGENLLYSDGEKSDYEWLVTPPGSPSRNVTNHLN
FT                   APDDNLMTLISRLENYSKEESEHQTTSLHSSSSVSGIRRPSSSSSSRSTSRPPTPTRKS
FT                   KTPAKRPSTPTSRATSTTTRATLTSSSTTSSTRSWSRPSSSSGTGTSRVTLTAARATRP
FT                   TTSTDQQTTGSATSTRSNNRPMSAPNSKPGSRSSTPTRRPSTPNGSSTVLRSKPTKPLS
FT                   KPALSLEASPIVRSRPWEPYEMPGFSVEAPSNLRTTLPDRPQTASSSRTRAFDASSSSR
FT                   SASTERDVAKRQSCSPSRSRAPNGNVNGAVPSLRGQRAKTNNDDGRLISHAAKGNQKVE
FT                   KVVNMRKLATPRLTESGSRRLGGGGGDSSAGKSSSGSGGFGFGRNLSKSSIDMALRHMV
FT                   R"
     atgtcgtctc aacaataccc tgtccggaga actgccgggg agaacttatt gtactccgat        60
     ggcgagaagt ccgattacga atggctggtc acgccaccag gctcaccgag tagaaacgta       120
     acgaaccacc tcaacgcacc cgatgataac ctgatgactc ttatatctcg gttagagaac       180
     tatagcaaag aagagtccga gcaccaaacg acgtcgttac acagttcctc ctctgtttct       240
     ggaatcagaa gaccatcgtc ctctagtagc tcaagatcaa cgagtagacc tcccacgcca       300
     accagaaagt ctaaaactcc agccaaaagg ccatcaacgc cgacctcacg tgccacctca       360
     acaactacac gtgcgacatt aacctcgtcc tctactacta gctcaacaag atcatggagc       420
     agaccttcct ctagctccgg aactggaacc tcacgtgtta ccttaaccgc tgcacgtgca       480
     accaggccca ccacctcaac agaccaacaa actaccggtt cagccacctc tactcgatcc       540
     aataacaggc cgatgtcggc tcctaattca aaaccgggat cgaggtcaag tactccaact       600
     cgccgtccat caactccgaa cggttcatcg actgtactga gaagtaaacc aactaagcct       660
     ttgagtaaac cggctctgtc tttagaagct tctccgatcg tgagatcaag gccatgggaa       720
     ccttacgaga tgcctggatt ctcagtagaa gcgccatcga atctcagaac tacgttacca       780
     gataggccac aaaccgcttc aagtagcaga accagagcct ttgatgcgtc aagtagttca       840
     agatcagcgt ccacagaacg cgatgttgca aagaggcaat cgtgttcgcc ttctagaagc       900
     cgagctccta atggaaacgt aaatggtgct gttccttcgt tacgtggaca acgagcaaag       960
     actaacaacg atgatggtag attgataagt catgcggcta aggggaatca aaaggtcgag      1020
     aaagttgtga atatgagaaa acttgctaca ccgcgactga cagaaagcgg cagtcgacga      1080
     cttggtggag gtggcggaga ctcctccgct gggaagtcga gctctggatc tggtggtttt      1140
     gggtttggta gaaacctatc taaaagctcc atcgacatgg ccttgagaca catggtacgg      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page