(data stored in ACNUC13479 zone)

EMBL: CP002688.PE55

CP002688.PE55        Location/Qualifiers
FT   CDS_pept        join(117520..117618,117742..117859,117933..118084,
FT                   118160..118243,118330..118392,118522..118656,
FT                   118749..118955,119355..119474,119697..119746,
FT                   119877..120039,120120..120260,120426..120533,
FT                   120615..120713,120864..121172,121267..121392)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.2"
FT                   /locus_tag="AT5G01290"
FT                   /product="mRNA capping enzyme family protein"
FT                   /note="mRNA capping enzyme family protein; FUNCTIONS IN:
FT                   phosphatase activity, protein tyrosine phosphatase
FT                   activity, protein tyrosine/serine/threonine phosphatase
FT                   activity, mRNA guanylyltransferase activity, polynucleotide
FT                   5'-phosphatase activity; INVOLVED IN: protein amino acid
FT                   dephosphorylation, mRNA processing, mRNA capping,
FT                   dephosphorylation; LOCATED IN: nucleus; EXPRESSED IN: 24
FT                   plant structures; EXPRESSED DURING: 15 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Nucleic acid-binding, OB-fold
FT                   (InterPro:IPR012340), Dual-specific/protein-tyrosine
FT                   phosphatase, conserved region (InterPro:IPR000387), mRNA
FT                   capping enzyme (InterPro:IPR001339), mRNA capping enzyme,
FT                   bifunctional (InterPro:IPR017074), Protein-tyrosine
FT                   phosphatase, active site (InterPro:IPR016130), Nucleic
FT                   acid-binding, OB-fold-like (InterPro:IPR016027), Dual
FT                   specificity phosphatase, catalytic domain
FT                   (InterPro:IPR000340), mRNA capping enzyme, C-terminal
FT                   (InterPro:IPR013846); BEST Arabidopsis thaliana protein
FT                   match is: mRNA capping enzyme family protein
FT                   (TAIR:AT3G09100.2); Has 888 Blast hits to 860 proteins in
FT                   246 species: Archae - 0; Bacteria - 2; Metazoa - 276; Fungi
FT                   - 241; Plants - 79; Viruses - 71; Other Eukaryotes - 219
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01290"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01290.1"
FT                   /db_xref="GOA:Q8GSD7"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR017074"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GSD7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:Z17627.1,INSD:AV798196.1,INSD:BP563844.1,
FT                   INSD:DR355246.1,INSD:BP591967.1,INSD:BP588577.1,
FT                   INSD:AV786438.1,INSD:EL171779.1,INSD:BP797965.1,
FT                   INSD:BP834070.1,INSD:BP824094.1,INSD:EH939563.1,
FT                   INSD:BP568835.1,INSD:EL131410.1,INSD:BP571238.1,
FT                   INSD:BP586097.1,INSD:AV822021.1,INSD:BP616965.1,
FT                   INSD:BP833437.1,INSD:BE526500.1,INSD:BP612120.1,
FT                   INSD:AV782639.1,INSD:BP575137.1,INSD:ES160931.1,
FT                   INSD:AV824508.1,INSD:BP565862.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT000440.1,INSD:BT001162.1"
FT                   /protein_id="AED90323.1"
FT                   /translation="MDLNASPQPEEDDEPFKRRHEDRMESAVEIARREREERKKRMRFD
FT                   RPTRVSQPAFRDQYRDTRVYDQSKLPQGWLDCPGFGLEIGCIIPSKVPLSESYNEHVPP
FT                   GKRYSFKQVVRNQRINGRKLGLVIDLTNTTRYYPTLDLKKDGIKHVKIACRGRDAVPDN
FT                   VSVNTFVNEVLQFVLNQKHAKKYVLVHCTHGHNRTGFMIVHYLMRSMPTMNVTQALKLF
FT                   SDARPPGIYKPDYIDALYTFYHEIKPESVTCPPTPEWKRSAELDLNGEAVQDDDDDDSP
FT                   PDPVQEINQENVKMSNDDTLGDEIPHYQEEAYRQFCYKMLMMNVGGRGFMQFPGSHPVS
FT                   LDRESLQLLRQRYYYATWKADGTRYMMLLTIDGCYLIDRSFKFRRVQMRFPCKHSREGI
FT                   SDKVHHYTLLDGEMVIDTPTGEQGEARRRYLVYDMVAINGESVVERTFCERWNMFVREV
FT                   IGPRAAEKLRSHCYRYDLEPFAVRMKGFWLLSTVEKLLKNTIPSLSHEADGLIFQGWDD
FT                   PYVPRTHKGLLKWKYAEMNSVDFLYEMGEEEGRGFLFLHERGKKKLMEGYSVEFRDDSD
FT                   PSSYNGKIVECAWDKDKKVWFSMRIRVDKTTPNDINTARKVIKSINDNITEEVLLQEIR
FT                   EIIRLPMYADRIRNDSQAARRR"
     atggacctaa atgcttcacc acaacccgaa gaagacgatg aaccctttaa gagacgtcat        60
     gaagatcgaa tggaatctgc tgttgagatc gctagacggg agcgtgaaga acgaaagaaa       120
     cgaatgagat ttgataggcc aacacgagtc tctcagccgg cttttcgtga tcagtataga       180
     gatactagag tttatgatca aagcaagctt cctcagggtt ggctagattg tcctggtttt       240
     ggtctggaga taggatgtat tattccttct aaggttccac ttagtgaatc ttacaacgaa       300
     catgttcctc ctggtaaaag atactctttc aaacaggtgg ttcgtaacca gagaattaat       360
     ggaagaaaac ttggtctagt cattgatctt actaatacaa ctcgttacta ccctacatta       420
     gacttaaaga aggatggcat caagcatgtt aagattgcat gcaggggtcg tgatgctgtg       480
     cctgataatg tctctgtaaa cacctttgtc aacgaggttc tgcagttcgt ccttaatcaa       540
     aaacacgcaa agaagtatgt cctcgtccac tgtacacatg ggcataatcg gacagggttc       600
     atgatagttc attatctcat gcgctctatg ccaacgatga acgttacaca ggcattgaag       660
     ttgttttctg atgcccgccc acctgggatt tataaaccag attatattga tgctttatac       720
     actttttatc acgaaataaa gcctgaaagt gttacttgcc caccaactcc tgaatggaag       780
     aggtctgccg agcttgatct taatggtgaa gctgttcaag atgatgatga tgatgattct       840
     ccgcctgacc ctgttcaaga aatcaatcag gagaatgtga agatgtcaaa tgatgacact       900
     ttgggtgatg aaatacccca ttatcaggag gaagcttacc ggcaattctg ttataaaatg       960
     cttatgatga atgttggggg aagaggattt atgcaattcc caggttcgca ccctgtatca      1020
     ttagacaggg agagtttgca acttttgagg cagcgatact attatgcgac atggaaggca      1080
     gatggaacac gttatatgat gctcttaact atagatgggt gctatttgat agataggagc      1140
     tttaagtttc ggagggtaca gatgcgtttt ccctgtaagc actcacgtga gggaatttct      1200
     gataaagtgc atcactacac tttgcttgat ggagagatgg tcatagatac cccgacaggt      1260
     gagcaagggg aggcaaggag gaggtatctc gtatatgata tggtagcaat caatggtgaa      1320
     tcagttgtag agcggacttt ctgtgaaaga tggaacatgt tcgtgcgtga ggtgatcgga      1380
     cctcgagcag ctgagaagct cagaagtcat tgctacagat atgaccttga gccttttgcg      1440
     gtacggatga agggtttctg gttactttct actgttgaga agctgttgaa gaataccatt      1500
     ccatcgcttt cgcatgaagc agatggctta atatttcagg gttgggatga tccgtatgtt      1560
     ccacgaaccc ataaaggtct actgaagtgg aagtatgcag aaatgaactc agtagacttt      1620
     ctgtatgaga tgggtgagga agaggggcgt ggtttcctct tcttgcatga aagagggaag      1680
     aaaaagctta tggaaggata ttcagttgag tttagagatg attcggaccc gtcaagttac      1740
     aatgggaaga ttgtagaatg tgcttgggat aaggataaga aagtttggtt tagcatgagg      1800
     atcagagttg acaaaactac accaaatgat atcaacactg ctcgtaaggt gataaagagc      1860
     ataaatgata acatcactga ggaggttttg cttcaggaaa taagagagat cattcgtctc      1920
     ccaatgtacg ctgaccgcat tcgaaatgat agtcaagctg cccgccgccg gtag            1974
//

If you have problems or comments...

PBIL Back to PBIL home page