(data stored in ACNUC13479 zone)

EMBL: CP002688.PE56

CP002688.PE56        Location/Qualifiers
FT   CDS_pept        complement(join(121643..121717,121817..122111,
FT                   122330..122448))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.10"
FT                   /gene_synonym="T10O8_10"
FT                   /locus_tag="AT5G01300"
FT                   /product="PEBP (phosphatidylethanolamine-binding protein)
FT                   family protein"
FT                   /note="PEBP (phosphatidylethanolamine-binding protein)
FT                   family protein; FUNCTIONS IN: phosphatidylethanolamine
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 7 plant
FT                   structures; EXPRESSED DURING: LP.04 four leaves visible, 4
FT                   anthesis, 4 leaf senescence stage, petal differentiation
FT                   and expansion stage, LP.08 eight leaves visible; CONTAINS
FT                   InterPro DOMAIN/s: YbhB/YbcL (InterPro:IPR005247),
FT                   Phosphatidylethanolamine-binding protein PEBP
FT                   (InterPro:IPR008914); Has 1807 Blast hits to 1807 proteins
FT                   in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736;
FT                   Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes -
FT                   339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M042"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M042"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP825736.1,INSD:Z17627.1,INSD:AV798196.1,
FT                   INSD:BP563844.1,INSD:BP591967.1,INSD:BP588577.1,
FT                   INSD:AV786438.1,INSD:BP815018.1,INSD:BP568835.1,
FT                   INSD:Z17689.1,INSD:BP571238.1,INSD:BP823076.1,
FT                   INSD:BP616965.1,INSD:BP648514.1,INSD:BP612120.1,
FT                   INSD:AV782639.1,INSD:BP575137.1,INSD:ES160931.1,
FT                   INSD:AV824508.1,INSD:BP565862.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX833357.1,INSD:BX833686.1,INSD:BX833214.1,
FT                   INSD:AY065369.1,INSD:AY096477.1"
FT                   /protein_id="AED90324.1"
FT                   /translation="MSSEELRLVSPTIDNDGKLPRKYTMAGQGVKKDISPPLEWYNVPE
FT                   GTKTLALVVEDIDAPDPSGPLVPWTVWVVVDIPPEMKGLPEGYSGNEDQTTGIREGNND
FT                   HKIPGWRGPLLPSHGHRFQFKLFALDDKPKIGHTVTKERLLIAIEGHVLGEAILTCLA"
     atgtcgagtg aggagttgag gctggtttcg ccgacgatag acaacgatgg gaagttgccg        60
     agaaagtata cgatggcagg tcaaggtgtt aagaaagaca tctctcctcc tcttgaatgg       120
     tacaacgttc cagaaggtac aaaaacgcta gctttggtgg tggaagacat cgatgcgcct       180
     gatcctagtg gcccgctggt gccatggacg gtgtgggttg tcgtcgacat accaccagag       240
     atgaaaggcc taccggaagg atattccggc aatgaggatc agactaccgg tattcgggaa       300
     gggaacaacg atcacaagat tccgggatgg cgtggacctc tcttacctag tcacggtcac       360
     cgttttcagt tcaagctttt tgctctcgat gataaaccca agattggtca cacggtgacg       420
     aaagagagat tgctgatcgc aattgaaggg cacgtgctag gagaagccat cttgacgtgt       480
     ttggcctaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page