(data stored in ACNUC13479 zone)

EMBL: CP002688.PE57

CP002688.PE57        Location/Qualifiers
FT   CDS_pept        complement(join(121643..121717,121817..122128))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.10"
FT                   /gene_synonym="T10O8_10"
FT                   /locus_tag="AT5G01300"
FT                   /product="PEBP (phosphatidylethanolamine-binding protein)
FT                   family protein"
FT                   /note="PEBP (phosphatidylethanolamine-binding protein)
FT                   family protein; FUNCTIONS IN: phosphatidylethanolamine
FT                   binding; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 7 plant
FT                   structures; EXPRESSED DURING: LP.04 four leaves visible, 4
FT                   anthesis, 4 leaf senescence stage, petal differentiation
FT                   and expansion stage, LP.08 eight leaves visible; CONTAINS
FT                   InterPro DOMAIN/s: YbhB/YbcL (InterPro:IPR005247),
FT                   Phosphatidylethanolamine-binding protein PEBP
FT                   (InterPro:IPR008914); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01300"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01300.2"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:B3H785"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP817557.1,INSD:BP568835.1,INSD:Z17627.1,
FT                   INSD:BP571238.1,INSD:BP586097.1,INSD:BP648514.1,
FT                   INSD:BP616965.1,INSD:BP819245.1,INSD:BP563844.1,
FT                   INSD:BP591967.1,INSD:BP588577.1,INSD:AV786438.1,
FT                   INSD:AV782639.1,INSD:BP575137.1,INSD:BP565862.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX833298.1"
FT                   /protein_id="AED90325.1"
FT                   /translation="MLIWCRYNVPEGTKTLALVVEDIDAPDPSGPLVPWTVWVVVDIPP
FT                   EMKGLPEGYSGNEDQTTGIREGNNDHKIPGWRGPLLPSHGHRFQFKLFALDDKPKIGHT
FT                   VTKERLLIAIEGHVLGEAILTCLA"
     atgttgatat ggtgtaggta caacgttcca gaaggtacaa aaacgctagc tttggtggtg        60
     gaagacatcg atgcgcctga tcctagtggc ccgctggtgc catggacggt gtgggttgtc       120
     gtcgacatac caccagagat gaaaggccta ccggaaggat attccggcaa tgaggatcag       180
     actaccggta ttcgggaagg gaacaacgat cacaagattc cgggatggcg tggacctctc       240
     ttacctagtc acggtcaccg ttttcagttc aagctttttg ctctcgatga taaacccaag       300
     attggtcaca cggtgacgaa agagagattg ctgatcgcaa ttgaagggca cgtgctagga       360
     gaagccatct tgacgtgttt ggcctaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page