(data stored in ACNUC13479 zone)

EMBL: CP002688.PE58

CP002688.PE58        Location/Qualifiers
FT   CDS_pept        complement(join(121729..121737,121817..122111,
FT                   122330..122448))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.10"
FT                   /gene_synonym="T10O8_10"
FT                   /locus_tag="AT5G01300"
FT                   /product="PEBP (phosphatidylethanolamine-binding protein)
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01300"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BD35"
FT                   /protein_id="ANM69512.1"
FT                   /translation="MSSEELRLVSPTIDNDGKLPRKYTMAGQGVKKDISPPLEWYNVPE
FT                   GTKTLALVVEDIDAPDPSGPLVPWTVWVVVDIPPEMKGLPEGYSGNEDQTTGIREGNND
FT                   HKIPGWRGPLLPSHGHRFQFKLFALDDKPKIGHTLF"
     atgtcgagtg aggagttgag gctggtttcg ccgacgatag acaacgatgg gaagttgccg        60
     agaaagtata cgatggcagg tcaaggtgtt aagaaagaca tctctcctcc tcttgaatgg       120
     tacaacgttc cagaaggtac aaaaacgcta gctttggtgg tggaagacat cgatgcgcct       180
     gatcctagtg gcccgctggt gccatggacg gtgtgggttg tcgtcgacat accaccagag       240
     atgaaaggcc taccggaagg atattccggc aatgaggatc agactaccgg tattcgggaa       300
     gggaacaacg atcacaagat tccgggatgg cgtggacctc tcttacctag tcacggtcac       360
     cgttttcagt tcaagctttt tgctctcgat gataaaccca agattggtca cacgttgttc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page