(data stored in ACNUC13479 zone)

EMBL: CP002688.PE59

CP002688.PE59        Location/Qualifiers
FT   CDS_pept        125304..125819
FT                   /codon_start=1
FT                   /locus_tag="AT5G01305"
FT                   /product="transcription factor bHLH140-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01305"
FT                   /db_xref="GOA:A0A178UDM7"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178UDM7"
FT                   /protein_id="ANM69513.1"
FT                   /translation="MDDFNLRSENPNSSSTTSSSSSSFHRHKSETGNTKRSRSTSTLST
FT                   DPQSVAARDRRHRISDRFKILQSMVPGGAKMDTVSMLDEAISYVKFLKAQIWYHQNMLL
FT                   FINDHETTSSCTYSPGAGEFGPKLFGYDDDYAPIMDTYSQGVPLTVADSKYTPWFGSVD
FT                   DEQERDSS"
     atggatgatt tcaatcttcg tagcgaaaac cctaattcat catccaccac ttcctcatcc        60
     tcttcctctt tccaccgtca caagagcgaa accggaaaca caaaacggtc aaggtcaacg       120
     tccacgttat cgacggaccc tcagagcgtg gcggctcgcg acagacggca ccgaattagc       180
     gaccgtttca agattttaca aagcatggtc cctggtggtg cgaagatgga cactgtatct       240
     atgcttgacg aagccattag ctacgtcaag ttcttgaagg ctcagatctg gtatcaccaa       300
     aacatgcttc tcttcataaa cgaccacgaa actacatcat cttgtactta ctctcccggc       360
     gctggagaat ttggaccgaa actctttggt tatgatgacg attatgcccc tataatggac       420
     acatattcac aaggcgtgcc acttacggtt gcggactcga agtatacgcc gtggtttggt       480
     tcggttgatg atgagcaaga acgtgactcg tcctag                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page