(data stored in ACNUC13479 zone)

EMBL: CP002688.PE6

CP002688.PE6         Location/Qualifiers
FT   CDS_pept        complement(join(5335..5576,5697..5769))
FT                   /codon_start=1
FT                   /locus_tag="AT5G01015"
FT                   /product="transmembrane protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: endomembrane system; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; BEST Arabidopsis
FT                   thaliana protein match is: unknown protein
FT                   (TAIR:AT1G65295.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01015.1"
FT                   /db_xref="GOA:Q8LBK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LBK1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR279885.1,INSD:DR279889.1,INSD:DR279890.1,
FT                   INSD:DR279892.1,INSD:EL185242.1,INSD:EH915082.1,
FT                   INSD:EH906100.1,INSD:EL138832.1,INSD:EL061886.1,
FT                   INSD:EH806402.1,INSD:DR374946.1,INSD:DR279886.1,
FT                   INSD:DR279891.1,INSD:DR279884.1,INSD:DR279881.1,
FT                   INSD:DR279883.1,INSD:EL041638.1,INSD:DR279887.1,
FT                   INSD:DR279888.1,INSD:DR279882.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT024551.1,INSD:BX833982.1,INSD:BX833637.1,
FT                   INSD:AY087164.1"
FT                   /protein_id="AED90286.1"
FT                   /translation="MESSLHSVIFLGLLATILVTTNGQGDGTGLNAEEMWPVEVGMEYR
FT                   VWRRKLMTPLELCLECKCCSSTTCATMPCCFGINCQLPNKPFGVCAFVPKSCHCNSCSI
FT                   "
     atggagtcta gcttgcatag tgtgattttc ttaggtttgc ttgcgacgat tctggttacg        60
     accaatggcc aaggagacgg gacggggcta aatgcagaag aaatgtggcc agtggaggtg       120
     gggatggagt atagagtatg gaggagaaag ctgatgacgc cattggagct gtgcttggag       180
     tgcaaatgct gctcctccac cacttgtgcc accatgcctt gctgtttcgg catcaattgc       240
     cagcttccca acaagccatt tggcgtttgt gcctttgttc ccaagtcatg ccattgtaat       300
     tcttgctcca tttga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page