(data stored in ACNUC13479 zone)

EMBL: CP002688.PE61

CP002688.PE61        Location/Qualifiers
FT   CDS_pept        complement(join(129484..129654,129722..130028,
FT                   130129..130779,130857..131020,131107..131625))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.30"
FT                   /gene_synonym="T10O8_30"
FT                   /locus_tag="AT5G01320"
FT                   /product="Thiamine pyrophosphate dependent pyruvate
FT                   decarboxylase family protein"
FT                   /note="Thiamine pyrophosphate dependent pyruvate
FT                   decarboxylase family protein; FUNCTIONS IN: in 6 functions;
FT                   LOCATED IN: cellular_component unknown; CONTAINS InterPro
FT                   DOMAIN/s: TPP-binding enzyme, conserved site
FT                   (InterPro:IPR000399), Thiamine pyrophosphate enzyme,
FT                   central domain (InterPro:IPR012000), Pyruvate
FT                   decarboxylase/indolepyruvate decarboxylase
FT                   (InterPro:IPR012110), Thiamine pyrophosphate enzyme,
FT                   N-terminal TPP-binding domain (InterPro:IPR012001),
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP-binding
FT                   (InterPro:IPR011766); BEST Arabidopsis thaliana protein
FT                   match is: Thiamine pyrophosphate dependent pyruvate
FT                   decarboxylase family protein (TAIR:AT4G33070.1); Has 1807
FT                   Blast hits to 1807 proteins in 277 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M040"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M040"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU236252.1,INSD:AU227094.1,INSD:BP575331.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BT004248.1"
FT                   /protein_id="AED90327.1"
FT                   /translation="MDTKIGAIDTCKPTTGDIGSPPSNAVATIQDSAPITTTSESTLGR
FT                   HLSRRLVQAGVTDVFSVPGDFNLTLLDHLIAEPELNNIGCCNELNAGYAADGYARSRGV
FT                   GACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDFGTNRILHHTIGLPDFSQEL
FT                   RCFQTVTCYQAVVNNLEDAHEQIDKAIATALKESKPVYISISCNLAATPHPTFARDPVP
FT                   FDLTPRMSNTMGLEAAVEATLEFLNKAVKPVMVGGPKLRVAKASEAFLELADASGYPLA
FT                   VMPSTKGLVPENHPHFIGTYWGAVSTPFCSEIVESADAYIFAGPIFNDYSSVGYSLLLK
FT                   KEKAIIVHPDRVVVANGPTFGCVLMSDFFRELAKRVKRNETAYENYERIFVPEGKPLKC
FT                   KPGEPLRVNAMFQHIQKMLSSETAVIAETGDSWFNCQKLKLPKGCGYEFQMQYGSIGWS
FT                   VGATLGYAQATPEKRVLSFIGDGSFQVTAQDISTMIRNGQKAIIFLINNGGYTIEVEIH
FT                   DGPYNVIKNWNYTGLVDAIHNGEGKCWTTKVRYEEELVEAIKTATTEKKDSLCFIEVIV
FT                   HKDDTSKELLEWGSRVSAANGRPPNPQ"
     atggacacca aaattggagc catcgacacg tgtaagccaa caactggtga catcggaagt        60
     ccaccaagca acgccgtcgc aacaatccaa gactccgctc ccatcaccac aacctccgaa       120
     tcgactctag gacgtcactt atcccgccgt cttgtccaag ccggagtcac cgatgttttc       180
     tctgttcccg gtgatttcaa cctaactctt ctcgaccacc tcatcgccga gccagagctc       240
     aacaacatcg gatgctgtaa cgagcttaac gccggttacg ccgccgatgg atacgctcga       300
     tctcgtggag tcggtgcttg cgtcgtgact ttcaccgttg gtggactcag cgttttgaac       360
     gctatcgctg gtgcgtacag tgagaaccta ccagttatat gtatcgttgg aggtcctaac       420
     tccaacgatt ttggcactaa ccggattctt catcacacca tcggtttacc tgactttagc       480
     caagagctta ggtgtttcca aactgttact tgctaccagg ctgtggtgaa caatttggag       540
     gatgctcatg aacagatcga caaggcgata gcaacagctt tgaaagagag caagcctgtg       600
     tacattagca tcagttgcaa cttagctgca actcctcatc ctacgtttgc tcgtgatcct       660
     gtcccttttg acctaactcc taggatgagc aacacgatgg gtttagaagc tgcggtggaa       720
     gcaacattgg agtttctgaa caaggcagtg aagccagtta tggttggtgg cccaaagttg       780
     cgtgtggcta aagcaagtga ggcctttttg gagctagctg atgcttcagg ctaccctctc       840
     gcagtgatgc cttctacaaa aggccttgta ccagagaacc atcctcattt cattggcact       900
     tactggggag cagtaagcac acctttctgc tctgagattg tcgaatctgc ggatgcttac       960
     atcttcgcag gtccaatctt caacgactac agctccgtag gttactctct tctcctcaag      1020
     aaagaaaaag caataattgt gcatcctgat cgagtcgttg tggctaatgg tccaacgttt      1080
     ggttgcgttc tgatgagcga tttcttcagg gagttggcta agagggttaa gcgtaacgag      1140
     acagcttatg agaactatga gaggatcttt gtacctgaag gtaagccatt gaaatgcaaa      1200
     ccaggagagc cattgagggt caacgcaatg ttccaacaca ttcagaagat gctctctagt      1260
     gaaaccgctg tgattgctga aactggtgat tcttggttca attgtcagaa gctaaagctg      1320
     cctaaaggat gtgggtacga gtttcagatg cagtatggat ccattggttg gtctgttggt      1380
     gcgactctag gatacgccca agcaaccccg gagaagagag tgttgtcttt cattggagat      1440
     gggagtttcc aagtgactgc tcaggacata tccacgatga ttcgtaacgg acagaaggcg      1500
     atcatcttct tgatcaacaa cggtggctac accattgaag ttgagattca tgatggtcct      1560
     tacaatgtta tcaagaactg gaactacact ggtcttgtcg atgctattca taacggtgaa      1620
     ggaaaatgct ggaccacaaa ggtgagatac gaggaggagt tagtggaagc gattaagact      1680
     gcgacaacgg agaagaaaga tagtctttgt ttcattgaag tgattgttca caaagatgat      1740
     acaagcaaag agttgcttga gtggggatct cgcgtctcag ctgctaatgg tcgtcctccc      1800
     aatcctcagt ag                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page