(data stored in ACNUC13479 zone)

EMBL: CP002688.PE64

CP002688.PE64        Location/Qualifiers
FT   CDS_pept        complement(join(145865..145882,145970..146028,
FT                   146117..146178,146832..146911))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.60"
FT                   /gene_synonym="T10O8_60"
FT                   /locus_tag="AT5G01350"
FT                   /product="UvrABC system C protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: endomembrane system; EXPRESSED IN: 24 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; Has 30201 Blast hits to
FT                   17322 proteins in 780 species: Archae - 12; Bacteria -
FT                   1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses
FT                   - 0; Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01350"
FT                   /db_xref="GOA:Q93W37"
FT                   /db_xref="UniProtKB/TrEMBL:Q93W37"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP842704.1,INSD:EH796554.1,INSD:ES148942.1,
FT                   INSD:T21390.1,INSD:BP613777.1,INSD:DR199789.1,
FT                   INSD:BP574685.1,INSD:EG430136.1,INSD:DR199782.1,
FT                   INSD:EL194481.1,INSD:EG494940.1,INSD:EL341518.1,
FT                   INSD:DR375615.1,INSD:ES146583.1,INSD:BP627499.1,
FT                   INSD:EL970753.1,INSD:BP841177.1,INSD:ES009944.1,
FT                   INSD:ES097092.1,INSD:ES077643.1,INSD:ES203913.1,
FT                   INSD:EL991741.1,INSD:ES193884.1,INSD:ES012011.1,
FT                   INSD:EL113839.1,INSD:ES127152.1,INSD:ES147740.1,
FT                   INSD:BP589826.1,INSD:ES021255.1,INSD:DR199787.1,
FT                   INSD:ES028242.1,INSD:BP858269.1,INSD:EH963010.1,
FT                   INSD:AV793434.1,INSD:ES046655.1,INSD:ES115193.1,
FT                   INSD:DR199791.1,INSD:BP635442.1,INSD:ES145319.1,
FT                   INSD:AV822102.2,INSD:EH925386.1,INSD:EH995020.1,
FT                   INSD:DR199786.1,INSD:BP851171.1,INSD:EL334695.1,
FT                   INSD:EL082891.1,INSD:EL140182.1,INSD:DR199783.1,
FT                   INSD:DR199792.1,INSD:ES084584.1,INSD:DR199790.1,
FT                   INSD:BP804354.1,INSD:AV782748.1,INSD:AV831682.1,
FT                   INSD:EH839570.1,INSD:EL988881.1,INSD:ES075529.1,
FT                   INSD:DR199794.1,INSD:AV809378.1,INSD:AV817384.1,
FT                   INSD:EL107638.1,INSD:BP849626.1,INSD:AV534832.1,
FT                   INSD:EH804134.1,INSD:BP659264.1,INSD:AV815392.1,
FT                   INSD:ES098056.1,INSD:EL129205.1,INSD:BP669402.1,
FT                   INSD:ES160848.1,INSD:ES149992.1,INSD:ES142317.1,
FT                   INSD:DR199780.1,INSD:BP868979.1,INSD:BP624367.1,
FT                   INSD:ES047204.1,INSD:DR199781.1,INSD:ES206827.1,
FT                   INSD:EL086476.1,INSD:BP579116.1,INSD:ES185303.1,
FT                   INSD:ES094329.1,INSD:ES077166.1,INSD:BP852700.1,
FT                   INSD:BP851547.1,INSD:ES198685.1,INSD:EL311357.1,
FT                   INSD:EL985019.1,INSD:AV826059.1,INSD:BP596951.1,
FT                   INSD:EL996756.1,INSD:BP668341.1,INSD:BP847308.1,
FT                   INSD:ES041357.1,INSD:ES127858.1,INSD:DR199785.1,
FT                   INSD:BP623999.1,INSD:ES024267.1,INSD:ES182581.1,
FT                   INSD:ES076680.1,INSD:BP806614.1,INSD:CD529673.1,
FT                   INSD:DR199795.1,INSD:AV803805.1,INSD:DR199788.1,
FT                   INSD:ES178346.1,INSD:BP628012.1,INSD:AV808324.1,
FT                   INSD:ES179053.1,INSD:AV790569.1,INSD:BP854146.1,
FT                   INSD:BP623772.1,INSD:EG430135.1,INSD:AV785554.1,
FT                   INSD:EG444549.1,INSD:DR199793.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF375457.1,INSD:AY060544.1,INSD:AK230394.1,
FT                   INSD:AY087482.1,INSD:BX831974.1,INSD:AY045661.1"
FT                   /protein_id="AED90330.1"
FT                   /translation="MAGGGNFIARVISYVANEFIVNGLANSHAFQRFAVRTSKRIENLS
FT                   KMAAENREKVAQQMEEFAKNIDSTKKP"
     atggcgggag gaggaaactt tattgcgaga gtgatctcat acgttgcgaa cgagttcata        60
     gttaatggtt tggcaaacag ccatgctttc cagagatttg ctgtgaggac ttcaaagaga       120
     atagaaaacc tctctaaaat ggctgcagag aacagggaga aagtcgctca gcaaatggaa       180
     gaatttgcca agaacattga ctccacgaag aaaccctga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page