(data stored in ACNUC13479 zone)

EMBL: CP002688.PE66

CP002688.PE66        Location/Qualifiers
FT   CDS_pept        complement(join(147608..147941,148018..148376,
FT                   148502..148673,148764..149035))
FT                   /codon_start=1
FT                   /gene="TBL3"
FT                   /gene_synonym="T10O8.70"
FT                   /gene_synonym="T10O8_70"
FT                   /gene_synonym="TRICHOME BIREFRINGENCE-LIKE 3"
FT                   /locus_tag="AT5G01360"
FT                   /product="trichome birefringence-like protein (DUF828)"
FT                   /note="TRICHOME BIREFRINGENCE-LIKE 3 (TBL3); CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF231,
FT                   plant (InterPro:IPR004253); BEST Arabidopsis thaliana
FT                   protein match is: Plant protein of unknown function
FT                   (DUF828) (TAIR:AT3G55990.1); Has 1290 Blast hits to 1278
FT                   proteins in 29 species: Archae - 0; Bacteria - 0; Metazoa -
FT                   3; Fungi - 2; Plants - 1285; Viruses - 0; Other Eukaryotes
FT                   - 0 (source: NCBI BLink)."
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="InterPro:IPR029972"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2H1ZE45"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU235894.1,INSD:DR249278.1,INSD:BP797316.1"
FT                   /protein_id="AED90332.2"
FT                   /translation="MKFPCFSLLPEEKIRKERSEILEVLDDRFEFDPEECNVAAGKWVY
FT                   NSSIEPLYTDRSCPYIDRQFSCMKNGQPETDYLRWEWQPDDCTIPRFSPKLAMNKLRGK
FT                   RLLFVGDSLQRSQWESFVCLVESIIPEGEKSMKRSQKYFVFKAKEYNATIEFYWAPYIV
FT                   ESNTDIPVISDPKKRIVKVDSVKDRAKFWEGADILVFNTYVWWMSGLRMKALWGSFGNG
FT                   ESGAEALDTQVAYRLGLKTWANWVDSTVDPNKTRVFFTTMSPTHTRSADWGKPNGTKCF
FT                   NETKPIKDKKFWGTGSNKQMMKVVSSVIKHMTTHVTVINITQLSEYRIDAHTSVYTETG
FT                   GKILTAEQRADPMHHADCIHWCLPGLPDTWNRILLAHL"
     atgaaattcc cctgcttttc cttgttgcca gaggagaaaa ttcgaaagga aagatcagag        60
     atattggaag tgcttgacga caggttcgaa ttcgatcccg aagagtgtaa cgttgcagca       120
     gggaaatggg tttacaatag ctcaattgaa ccactctaca ccgatagatc atgtccatac       180
     atcgatcgtc aattctcttg tatgaaaaac ggacagccag aaactgatta tcttcggtgg       240
     gaatggcagc ctgatgactg tacaattcca cgatttagtc cgaagttagc aatgaacaaa       300
     ctcagaggaa aaagactact ttttgtggga gattcgttgc aacgaagcca atgggaatcg       360
     ttcgtgtgtt tggtggaatc aataataccc gaaggagaaa aatcaatgaa gcgtagccaa       420
     aaatactttg tatttaaagc aaaggaatac aatgcgacta tagagttcta ttgggcaccg       480
     tatatcgtcg aatcaaacac agatatacct gtgatttcgg atccaaagaa acggatagtg       540
     aaagtggact cagtgaaaga tcgagctaag ttttgggaag gagctgatat tttggttttc       600
     aacacttatg tttggtggat gagtggtctc cgcatgaaag ctctgtgggg ttctttcgga       660
     aatggagaga gtggtgcaga ggcactagac acacaagtgg cttacaggct aggactcaag       720
     acatgggcta attgggtaga ctccaccgtt gaccctaata agaccagagt cttcttcacc       780
     accatgtctc ctactcatac tagaagtgcg gattggggaa agccaaacgg cacgaagtgt       840
     ttcaacgaga cgaaaccgat aaaagataag aagttttggg gaacaggctc taacaagcag       900
     atgatgaaag tagtgtcaag cgtgataaag cacatgacta cgcatgtgac agtcatcaac       960
     atcacgcagc tctctgagta tcgcatcgac gctcacacat cagtttacac cgagacaggt      1020
     ggcaagatcc taaccgctga gcagagggct gatccaatgc atcacgctga ttgtatacat      1080
     tggtgtttac ctggactacc cgatacatgg aatcggatcc tattggctca tttgtaa         1137
//

If you have problems or comments...

PBIL Back to PBIL home page