(data stored in ACNUC13479 zone)

EMBL: CP002688.PE68

CP002688.PE68        Location/Qualifiers
FT   CDS_pept        complement(join(155784..156419,157116..157451))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.90"
FT                   /gene_synonym="T10O8_90"
FT                   /locus_tag="AT5G01380"
FT                   /product="Homeodomain-like superfamily protein"
FT                   /note="Homeodomain-like superfamily protein; CONTAINS
FT                   InterPro DOMAIN/s: SANT, DNA-binding (InterPro:IPR001005),
FT                   MYB-like (InterPro:IPR017877); BEST Arabidopsis thaliana
FT                   protein match is: Homeodomain-like superfamily protein
FT                   (TAIR:AT2G38250.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01380"
FT                   /db_xref="GOA:Q9SDW0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR027759"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SDW0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV554251.1,INSD:DR369042.1,INSD:EG461216.1,
FT                   INSD:CB254283.1,INSD:AV545513.1,INSD:CB254566.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT028926.1,INSD:AY271677.1"
FT                   /protein_id="AED90334.1"
FT                   /translation="MDRRNPFQHHHHHHQLHHHLIQQQQLPPPPLSTTATMDPGGGGGG
FT                   GERIPQWSIEETKELLAIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSAEQCKSKW
FT                   KNLVTRYKACETTEPDAIRQQFPFYNEIQSIFEARMQRMLWSEATEPSTSSKRKHHQFS
FT                   SDDEEEEVDEPNQDINEELLSLVETQKRETEVITTSTSTNPRKRAKKGKGVASGTKAET
FT                   AGNTLKDILEEFMRQTVKMEKEWRDAWEMKEIEREKREKEWRRRMAELEEERAATERRW
FT                   MEREEERRLREEARAQKRDSLIDALLNRLNRDHNDDHHNQGF"
     atggaccgac gtaacccttt ccaacatcac caccaccacc atcagcttca tcatcacttg        60
     atccaacagc aacagcttcc tccgccgccg ctgagcacca cggcgacgat ggatcccggc       120
     ggaggaggag gaggtgggga gagaatccca cagtggagca tagaggagac aaaggagctt       180
     ttggctataa gagaagaact tgatcaaact ttcatggaga ccaaacgtaa taagcttctt       240
     tgggaagtcg tggctgctaa gatggccgac aagggttttg tccgaagcgc agaacaatgt       300
     aagagcaagt ggaagaacct cgtcactaga tacaaggcgt gtgagaccac tgagccagat       360
     gctattaggc agcagttccc attctacaat gagattcagt cgatttttga agcaagaatg       420
     caaagaatgc tgtggtcaga agccacagaa ccaagcactt cctcgaagag aaaacatcat       480
     caattttcat ctgatgatga agaagaagaa gttgacgaac caaatcaaga tatcaacgag       540
     gaattattgt ctttagtaga gacacagaaa agagagacag aagtgattac tactagtact       600
     tcgaccaatc caagaaaacg tgcaaaaaaa ggaaaaggcg ttgcgagtgg tacgaaagct       660
     gaaactgcgg gtaatacact aaaagatata ttggaggagt ttatgaggca aacggtgaag       720
     atggaaaagg aatggagaga tgcatgggag atgaaggaga tagagaggga gaagagagag       780
     aaagagtggc ggaggagaat ggcggagcta gaggaggaaa gagccgccac agaaaggagg       840
     tggatggaga gagaggaaga gagacggttg agagaagaag ctagggctca gaagagagat       900
     tctctcatcg atgctttgct taataggctt aatagagatc ataatgatga tcatcataat       960
     caaggtttct aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page