(data stored in ACNUC13479 zone)

EMBL: CP002688.PE69

CP002688.PE69        Location/Qualifiers
FT   CDS_pept        complement(join(160500..160735,160853..160938,
FT                   161720..161949,162035..162199))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.100"
FT                   /gene_synonym="T10O8_100"
FT                   /locus_tag="AT5G01390"
FT                   /product="DNAJ heat shock family protein"
FT                   /note="DNAJ heat shock family protein; FUNCTIONS IN:
FT                   unfolded protein binding, heat shock protein binding;
FT                   INVOLVED IN: protein folding; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Molecular chaperone, heat shock protein,
FT                   Hsp40, DnaJ (InterPro:IPR015609), HSP40/DnaJ
FT                   peptide-binding (InterPro:IPR008971), Chaperone DnaJ,
FT                   C-terminal (InterPro:IPR002939), Heat shock protein DnaJ,
FT                   N-terminal (InterPro:IPR001623), Heat shock protein DnaJ,
FT                   conserved site (InterPro:IPR018253); BEST Arabidopsis
FT                   thaliana protein match is: DNAJ heat shock family protein
FT                   (TAIR:AT3G08910.1); Has 27199 Blast hits to 26228 proteins
FT                   in 3366 species: Archae - 181; Bacteria - 10265; Metazoa -
FT                   4962; Fungi - 2544; Plants - 3099; Viruses - 15; Other
FT                   Eukaryotes - 6133 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01390"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01390.3"
FT                   /db_xref="GOA:F4K9C8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9C8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR285421.1,INSD:EL232018.1,INSD:EH852437.1,
FT                   INSD:AU231248.1,INSD:BP860877.1,INSD:BP852792.1,
FT                   INSD:EL151690.1,INSD:EH967560.1,INSD:DR285420.1,
FT                   INSD:ES069071.1,INSD:EH848080.1,INSD:EL333624.1,
FT                   INSD:AV562937.1,INSD:EH912646.1,INSD:EH849612.1"
FT                   /protein_id="AED90337.1"
FT                   /translation="MGVDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKKEAEA
FT                   KFKQISEAYDVLSDPQKRAIYEQYGEEGLNQAPPPGAGGGYPGGSDAGASFRFNPRSAD
FT                   DIFSEFFGFTRPSFGTGSDSRAGPSGFRRPTPVEEILTIEIKPGWKKGTKITFLEKVDA
FT                   LTGYTAQVTTLDGRTLTVPVNNVISPSYEEVVKGEGMPIPKDPSRKGNLRIRFIIKFPS
FT                   KLTTEQKSGIKRMLSP"
     atgggggttg atttctataa ggttcttgaa gttgatcgaa gtgctaatga cgacgagctt        60
     aagaaagctt atcgcaaact cgccatgaaa tggcatcctg ataagaaccc taacaacaaa       120
     aaagaagccg aagctaaatt caagcagatc tctgaagctt acgatgtttt gagtgatcct       180
     cagaaacgag caatctacga gcaatacgga gaagaaggtt taaaccaagc cccacctccc       240
     ggcgccggtg gtggctatcc tggaggatca gacgccggag cttctttccg gttcaatccc       300
     agaagcgctg atgatatctt ctccgagttc tttggtttca cgaggccttc ttttggtacg       360
     ggaagcgact cacgcgcagg accttctggc tttaggaggc caacaccggt tgaggagatc       420
     ttgacgatag aaattaaacc cggttggaaa aaaggaacaa agataacctt cctggaaaaa       480
     gtggatgctc tcacaggtta caccgcacag gtcactactc ttgacggaag aaccttaaca       540
     gttccggtaa acaatgtgat cagtccgtcg tacgaagagg tggtgaaagg agaaggcatg       600
     ccgatcccta aagatccgtc aagaaaagga aacttgagaa tcagattcat catcaagttc       660
     ccttcgaagc taaccactga gcagaaatca gggatcaagc ggatgttatc accttga          717
//

If you have problems or comments...

PBIL Back to PBIL home page