(data stored in ACNUC13479 zone)

EMBL: CP002688.PE7

CP002688.PE7         Location/Qualifiers
FT   CDS_pept        5339..5593
FT                   /codon_start=1
FT                   /locus_tag="AT5G01017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BAW4"
FT                   /protein_id="ANM68741.1"
FT                   /translation="MEQELQWHDLGTKAQTPNGLLGSWQLMPKQQGMVAQVVEEQHLHS
FT                   KHSSNGVISFLLHTLYSIPTSTGHISSAFSPVPSPTHNT"
     atggagcaag aattacaatg gcatgacttg ggaacaaagg cacaaacgcc aaatggcttg        60
     ttgggaagct ggcaattgat gccgaaacag caaggcatgg tggcacaagt ggtggaggag       120
     cagcatttgc actccaagca cagctccaat ggcgtcatca gctttctcct ccatactcta       180
     tactccatcc ccacctccac tggccacatt tcttctgcat ttagccccgt cccgtctcct       240
     acacataaca catga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page