(data stored in ACNUC13479 zone)

EMBL: CP002688.PE70

CP002688.PE70        Location/Qualifiers
FT   CDS_pept        complement(join(160500..160938,161720..161949,
FT                   162035..162199))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.100"
FT                   /gene_synonym="T10O8_100"
FT                   /locus_tag="AT5G01390"
FT                   /product="DNAJ heat shock family protein"
FT                   /note="DNAJ heat shock family protein; FUNCTIONS IN:
FT                   unfolded protein binding, heat shock protein binding;
FT                   INVOLVED IN: protein folding; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Molecular chaperone, heat shock protein,
FT                   Hsp40, DnaJ (InterPro:IPR015609), HSP40/DnaJ
FT                   peptide-binding (InterPro:IPR008971), Chaperone DnaJ,
FT                   C-terminal (InterPro:IPR002939), Heat shock protein DnaJ,
FT                   N-terminal (InterPro:IPR001623), Heat shock protein DnaJ
FT                   (InterPro:IPR003095), Heat shock protein DnaJ, conserved
FT                   site (InterPro:IPR018253); BEST Arabidopsis thaliana
FT                   protein match is: DNAJ heat shock family protein
FT                   (TAIR:AT3G08910.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01390"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01390.2"
FT                   /db_xref="GOA:B3H6P7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B3H6P7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR285421.1,INSD:EL232018.1,INSD:EH852437.1,
FT                   INSD:AU231248.1,INSD:BP852792.1,INSD:BP860877.1,
FT                   INSD:EL151690.1,INSD:EH967560.1,INSD:N95992.1,
FT                   INSD:DR285420.1,INSD:ES142308.1,INSD:EH848080.1,
FT                   INSD:EL333624.1,INSD:ES205994.1,INSD:ES213088.1,
FT                   INSD:AV562937.1,INSD:BP662376.1,INSD:EH912646.1,
FT                   INSD:EH849612.1"
FT                   /protein_id="AED90336.1"
FT                   /translation="MGVDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKKEAEA
FT                   KFKQISEAYDVLSDPQKRAIYEQYGEEGLNQAPPPGAGGGYPGGSDAGASFRFNPRSAD
FT                   DIFSEFFGFTRPSFGTGSDSRAGPSGFRRPTPVEEILTIEIKPGWKKGTKITFLEKGNE
FT                   HRGVIPSDLVFIVDEKPHPVFKRDGNDLVVMQKISLVDALTGYTAQVTTLDGRTLTVPV
FT                   NNVISPSYEEVVKGEGMPIPKDPSRKGNLRIRFIIKFPSKLTTEQKSGIKRMLSP"
     atgggggttg atttctataa ggttcttgaa gttgatcgaa gtgctaatga cgacgagctt        60
     aagaaagctt atcgcaaact cgccatgaaa tggcatcctg ataagaaccc taacaacaaa       120
     aaagaagccg aagctaaatt caagcagatc tctgaagctt acgatgtttt gagtgatcct       180
     cagaaacgag caatctacga gcaatacgga gaagaaggtt taaaccaagc cccacctccc       240
     ggcgccggtg gtggctatcc tggaggatca gacgccggag cttctttccg gttcaatccc       300
     agaagcgctg atgatatctt ctccgagttc tttggtttca cgaggccttc ttttggtacg       360
     ggaagcgact cacgcgcagg accttctggc tttaggaggc caacaccggt tgaggagatc       420
     ttgacgatag aaattaaacc cggttggaaa aaaggaacaa agataacctt cctggaaaaa       480
     ggtaatgagc atcgtggagt cataccatcc gatctcgttt tcatcgtaga cgagaaaccg       540
     catcccgttt tcaaacgaga cgggaatgat cttgtggtaa tgcaaaagat ttctctagtg       600
     gatgctctca caggttacac cgcacaggtc actactcttg acggaagaac cttaacagtt       660
     ccggtaaaca atgtgatcag tccgtcgtac gaagaggtgg tgaaaggaga aggcatgccg       720
     atccctaaag atccgtcaag aaaaggaaac ttgagaatca gattcatcat caagttccct       780
     tcgaagctaa ccactgagca gaaatcaggg atcaagcgga tgttatcacc ttga             834
//

If you have problems or comments...

PBIL Back to PBIL home page