(data stored in ACNUC13479 zone)

EMBL: CP002688.PE72

CP002688.PE72        Location/Qualifiers
FT   CDS_pept        complement(join(161413..161949,162035..162199))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.100"
FT                   /gene_synonym="T10O8_100"
FT                   /locus_tag="AT5G01390"
FT                   /product="DNAJ heat shock family protein"
FT                   /note="DNAJ heat shock family protein; FUNCTIONS IN:
FT                   unfolded protein binding, heat shock protein binding;
FT                   INVOLVED IN: protein folding; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 24 plant
FT                   structures; EXPRESSED DURING: 15 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Molecular chaperone, heat shock protein,
FT                   Hsp40, DnaJ (InterPro:IPR015609), HSP40/DnaJ
FT                   peptide-binding (InterPro:IPR008971), Chaperone DnaJ,
FT                   C-terminal (InterPro:IPR002939), Heat shock protein DnaJ,
FT                   N-terminal (InterPro:IPR001623), Heat shock protein DnaJ
FT                   (InterPro:IPR003095), Heat shock protein DnaJ, conserved
FT                   site (InterPro:IPR018253); BEST Arabidopsis thaliana
FT                   protein match is: DNAJ heat shock family protein
FT                   (TAIR:AT3G08910.1); Has 26610 Blast hits to 26386 proteins
FT                   in 3381 species: Archae - 182; Bacteria - 10306; Metazoa -
FT                   4695; Fungi - 2459; Plants - 2906; Viruses - 15; Other
FT                   Eukaryotes - 6047 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01390"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01390.4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9D0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR285421.1,INSD:EL232018.1,INSD:DR285422.1,
FT                   INSD:EH852437.1,INSD:ES113248.1,INSD:AU231248.1,
FT                   INSD:BP860877.1,INSD:BP852792.1,INSD:EL151690.1,
FT                   INSD:EH967560.1,INSD:DR285423.1,INSD:DR285420.1,
FT                   INSD:ES069071.1,INSD:EH848080.1,INSD:EL333624.1,
FT                   INSD:AV562937.1,INSD:ES038958.1,INSD:EH912646.1"
FT                   /protein_id="AED90338.2"
FT                   /translation="MGVDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKKEAEA
FT                   KFKQISEAYDVLSDPQKRAIYEQYGEEGLNQAPPPGAGGGYPGGSDAGASFRFNPRSAD
FT                   DIFSEFFGFTRPSFGTGSDSRAGPSGFRYGDDIFASFRAATTGGEASIPSRKSAPIERQ
FT                   LPCSLEDLYKGVSKKMKISRDVLDSSGFVFPLMITHLAFSRGIYLLLLANFFLEQFKLS
FT                   FCGVWFQMFSL"
     atgggggttg atttctataa ggttcttgaa gttgatcgaa gtgctaatga cgacgagctt        60
     aagaaagctt atcgcaaact cgccatgaaa tggcatcctg ataagaaccc taacaacaaa       120
     aaagaagccg aagctaaatt caagcagatc tctgaagctt acgatgtttt gagtgatcct       180
     cagaaacgag caatctacga gcaatacgga gaagaaggtt taaaccaagc cccacctccc       240
     ggcgccggtg gtggctatcc tggaggatca gacgccggag cttctttccg gttcaatccc       300
     agaagcgctg atgatatctt ctccgagttc tttggtttca cgaggccttc ttttggtacg       360
     ggaagcgact cacgcgcagg accttctggc tttaggtatg gcgatgatat cttcgcttcc       420
     ttcagggctg ctactaccgg aggagaagcc tccattcctt ctaggaaatc tgctcctatt       480
     gagagacaat tgccttgtag cttggaggat ttgtataaag gtgtctccaa gaagatgaag       540
     atctctcgtg atgttcttga ctcttccggg tttgtttttc cattgatgat cacacatttg       600
     gcttttagta gagggatata tctgctgctt ttggccaatt tctttctaga acagtttaaa       660
     ctctctttct gtggagtttg gttccaaatg tttagtctat ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page