(data stored in ACNUC13479 zone)

EMBL: CP002688.PE74

CP002688.PE74        Location/Qualifiers
FT   CDS_pept        complement(join(162803..163505,163615..163718,
FT                   163809..163892,163996..164040,164121..164192,
FT                   164295..164375,164517..164612,164685..164759,
FT                   164845..164892,164996..165079,165167..165274,
FT                   165352..165385,165470..165669,165790..165888,
FT                   165970..166017,166265..166507,166582..166698,
FT                   166988..167056,167391..167936,168051..168605,
FT                   168711..168830,169035..169206,169645..169813,
FT                   169924..169999,170082..170174,170284..170443,
FT                   170870..171072))
FT                   /codon_start=1
FT                   /gene="ESP4"
FT                   /gene_synonym="ENHANCED SILENCING PHENOTYPE 4"
FT                   /gene_synonym="T10O8.110"
FT                   /gene_synonym="T10O8_110"
FT                   /locus_tag="AT5G01400"
FT                   /product="HEAT repeat-containing protein"
FT                   /note="ENHANCED SILENCING PHENOTYPE 4 (ESP4); FUNCTIONS IN:
FT                   binding; INVOLVED IN: posttranscriptional gene silencing by
FT                   RNA, RNA processing; LOCATED IN: mRNA cleavage and
FT                   polyadenylation specificity factor complex; EXPRESSED IN:
FT                   23 plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Symplekin tight junction
FT                   protein C-terminal (InterPro:IPR022075), Armadillo-type
FT                   fold (InterPro:IPR016024), Protein of unknown function
FT                   DUF3453 (InterPro:IPR021850); BEST Arabidopsis thaliana
FT                   protein match is: unknown protein (TAIR:AT1G27595.1); Has
FT                   1807 Blast hits to 1807 proteins in 277 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M033"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022075"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M033"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES071419.1,INSD:ES072101.1,INSD:EH859230.1,
FT                   INSD:EH825985.1,INSD:AV545988.1,INSD:AV529152.1,
FT                   INSD:AV546483.1,INSD:DR383177.1,INSD:DR275772.1,
FT                   INSD:DR275773.1,INSD:T45463.1,INSD:AA394514.1,
FT                   INSD:ES017155.1,INSD:AV539512.1"
FT                   /protein_id="AED90339.1"
FT                   /translation="MASYSRARLKDLANSAKSATELPPKLQRLRYMRRDLQKDDSVFPT
FT                   ELLPHLFDLLSDQFGAVRKFVAEILGEIGLKYVELIPEIVPLLIKSLEDETPAVARQVI
FT                   ACGADLFRSTLERVAVQGLHSSELNDLLESSWTWLIKFKDEICSVAFKQGNSGVKLCAM
FT                   KFVEALILLYTPHEGIEADFNISILRGGHPVLKIGDLSIEASQKLGLLLDQLRHPAAKS
FT                   LNSSTIIVLINSLSSVAKKRPAYCGRILPVLLSLDPLSFLKGVYAAATNLALKTVFLSC
FT                   LKCTHPAAAPDRLTSALKEIEGGGQAAKAKDLFYKTNGSIQDKDSVEDTKVSVEENPLC
FT                   ASSDVAESNLSRKRSGSEYNIDLNGDASDGKRARITPSVSEESTDGLNGNDGVSLPRVA
FT                   STSTGPSDSRGVSDSGPAQQLVGLFGTLVSQGEKAIGSLEILISSISADLLTDVVMANM
FT                   HNIPPNCSSYADGTDELVMNMCIVGSDAQIKYPPSFVAGVLSLSTAFPPIAALINPHNE
FT                   DEEVYSVHVDQQMFPAEDARTPPGLLATCDTSFPENEESNTVSPQNVHYIGNRESGIPG
FT                   LESSAQHDGSGALVTNVLSSTNVEAASKNQNASFSGKLLVDVIPSMSVDKLEEFSPKAV
FT                   GTVASASQFVLPKISAPVVDLSDEEKDSLQKLVFLRIVEAYKQISMSGGSQLRFSLLAH
FT                   LGVEFPSELDPWKILQEHVLSDYLNHEGHELTVRVLYRLYGEAEAEQDFFSSTTAASAY
FT                   ESFLLTVAEALRDSFPPSDKSLSKLLGDSPHLPKSVLMLLESFCCPGSGEVEKDLQHGD
FT                   RVTQGLSAVWSLILMRPGIRNDCLNIALQSAVHHLEEIRMKAIRLVANKLYSLSFITEQ
FT                   IEEFAKDRLFSVVSDDCDKMDLDLKSPPNKPQHSISGMSMETPSEATSSSTSVTEAQRC
FT                   LSLYFALCTKVLRIFTILRLMTNLVFNIYKNASDPVKQAIHLQIPILVRTMGSSSELLK
FT                   IIADPPSGSDNLLIQVLQTLTEGPTPSSELILTIRKLFDTRIKDVEILFPILPFLPRDD
FT                   VLRIFPHMVNLPMEKFQVALSRVLQGSSQSGPVLSPSEALIAIHSIDPARDGIPLKQVT
FT                   DACNTCFAQRQTFTQQVLAGVLNQLVQQIPLPMLFMRTVLQAIGAFPALSDFILEILSR
FT                   LVSKQIWKYPKLWVGFLKCTQTTQPQSYKVLLQLPPLQLGNALTKIPALRAPLTAHASQ
FT                   PEIQSSLPRSTLAVLGLVPDSQGTQTSQVQANETQTSQEQQQQQASEPQQTSQSQQVSV
FT                   PLSHSQVDHQEPSQVVASQSQSSPIGTVQSAMSQSQNSPIDTGRSEMSQSQNSPIDTGR
FT                   SEMSQSQNSPIDTGRSEMSQSQNSPIDTGRSEMSESQSSPIGQSQSSPIGTGQSDMSQT
FT                   PQVSDSSAPEPTSHTRTSDPQASSQTLRDDDEKIDDTATSENEVTEIEKSKESSEEEEE
FT                   EEEEEE"
     atggcttcgt attcaagagc aaggcttaaa gatctcgcga attccgccaa atcagcgacg        60
     gaattgcctc ccaagctgca acgcttgcgc tatatgcgcc gggatttgca aaaagacgat       120
     tccgtttttc ccacggagtt gcttcctcac cttttcgatc ttctctccga tcaattcggt       180
     gctgtccgca agtttgtcgc cgagatactt ggtgaaattg gcctgaaata tgtggaatta       240
     atacctgaaa tagtgcccct tttaattaag tctcttgaag atgagacacc agctgtggcc       300
     aggcaggtca ttgcttgtgg agctgattta ttccgttcca ccctcgaaag agtggcagtt       360
     cagggtttgc attctagtga gttgaatgat cttcttgaat cttcatggac atggttgatt       420
     aagttcaagg atgaaatatg ctcagtggct ttcaagcaag gaaatagtgg tgtaaaatta       480
     tgcgctatga aatttgtgga agcgcttatt ctcttgtata ctcctcatga aggaattgaa       540
     gcagatttta atatatctat tctccgtggg ggtcatcctg ttttgaaaat tggagatttg       600
     tcaattgagg ccagccagaa attgggttta ctgcttgatc agcttaggca ccctgcagca       660
     aaatctctaa atagctcgac gattattgtt cttatcaata gtctttcatc agttgcaaag       720
     aaacgtcctg catactgtgg acgaattcta cctgttctac tgagcttgga tcccctaagc       780
     tttctcaaag gagtgtatgc tgcagcaaca aatcttgcct tgaagactgt atttctctcc       840
     tgcttgaaat gtacacatcc cgctgctgca ccggaccggt tgaccagtgc tcttaaagag       900
     atagaaggtg gaggtcaggc agccaaagcg aaagatctct tttacaagac taacggaagc       960
     attcaggaca aagacagtgt agaagatacc aaggtatcag tggaagagaa tcctctctgt      1020
     gcaagttctg atgtagcaga aagtaactta agtaggaaaa gatctggatc agaatacaat      1080
     attgatctaa atggagatgc ttccgatgga aaacgtgcaa gaataacacc ttctgtgtca      1140
     gaagaatcca ctgacggatt aaatggtaat gatggggtct ctctacctcg ggttgcttct      1200
     acctcgaccg gaccaagtga tagcagagga gtgagtgata gtggacctgc tcagcagcta      1260
     gttggtttgt ttggaacctt ggtttctcag ggtgaaaaag caattggatc tttggagatt      1320
     cttatttcaa gtatttcggc ggatttactt actgatgttg tgatggctaa tatgcataat      1380
     attccaccaa attgttcttc ttatgctgat ggcaccgatg agttggtgat gaacatgtgt      1440
     atagttggca gtgatgcaca aattaaatat ccaccatcat ttgtagcggg tgtcctttca      1500
     ttgtcaaccg cattcccacc aattgctgcc ctgataaatc ctcacaatga agatgaggaa      1560
     gtctattctg ttcatgtgga ccagcaaatg tttccagctg aagatgcaag aactccacct      1620
     ggcttattag ctacctgtga tacttctttt ccagaaaatg aagaaagcaa tactgtgtct      1680
     ccacaaaatg tgcattacat agggaataga gaaagtggaa tacctggact ggaatcttct      1740
     gctcaacatg atgggtcagg agcccttgtt actaatgtat tgagttctac gaatgtggag      1800
     gctgcaagca aaaatcaaaa tgcgagtttc agtggaaaac ttcttgtcga tgtaattccc      1860
     tcaatgtctg tggataagtt ggaggaattt agtccaaagg cggttggcac agttgcttcg      1920
     gcgagtcagt ttgtcttacc taagatatca gcacctgttg tcgacctttc tgatgaagag      1980
     aaagacagtt tacaaaagct ggtttttttg cgcattgttg aagcatataa gcaaatatca      2040
     atgtctggtg gctcacaact ccgcttttct cttcttgctc atttaggagt tgagtttcct      2100
     tcagagttag acccttggaa aatattacag gagcacgttc tctcggatta tttgaatcat      2160
     gagggacatg agttgactgt gcgggttctt tacaggctat acggggaggc agaagcagaa      2220
     caagatttct tctcttcaac tactgctgcg tctgcatatg aaagtttctt gctaactgtg      2280
     gctgaagcac taagagattc ttttccaccg tctgacaaat ctttaagtaa attgcttgga      2340
     gattctccac atctgccgaa atcagttctg atgttgttgg aatcgttttg ctgtcctgga      2400
     agtggtgaag ttgaaaagga tttacaacat ggagaccgtg ttactcaagg tctcagtgct      2460
     gtttggagcc tgattttaat gagacctgga atccggaatg actgcctgaa tatcgctttg      2520
     cagagtgctg ttcatcactt ggaagagatt cgcatgaaag caatccgcct ggtggcaaac      2580
     aaactctatt ctttatcatt cattacagaa cagattgagg aatttgcaaa ggataggcta      2640
     ttttctgtcg taagtgatga ttgtgataag atggatcttg atctgaaaag tccaccaaac      2700
     aaaccgcaac acagtattag tggtatgagt atggagacgc cctccgaagc aacatcatca      2760
     tcaacttcag ttactgaagc tcaacgctgc ttgtcactct attttgctct ctgtaccaag      2820
     gtcttgcgaa tttttaccat tcttcgacta atgactaatc tagtctttaa catatacaag      2880
     aatgcatcag atcccgttaa gcaggctatt catcttcaaa tccctattct agttcgtact      2940
     atgggctcat cctctgagct tcttaaaatt atagcagacc caccaagtgg gagtgacaac      3000
     cttcttatac aggttcttca aaccctcacc gaggggccca ctccttcttc agaattgata      3060
     cttactatac ggaagttgtt tgatacaaga ataaaggatg tagagattct tttcccaatt      3120
     ttgccattcc tgccaagaga tgatgttctc cgcatttttc cccatatggt gaatcttcct      3180
     atggagaaat tccaagttgc actttctcgt gtgctgcagg gatcatctca atctggccca      3240
     gtgctttctc catctgaagc tttaattgct atccatagca ttgacccagc aagagatgga      3300
     ataccactta aacaggtcac agatgcatgc aatacctgtt ttgcgcagag gcagacattc      3360
     actcaacagg ttttagccgg tgttctgaat caactggtcc agcaaattcc actgccaatg      3420
     ttattcatgc gtacagtttt acaagctatt ggtgcttttc cagctctgtc ggacttcatc      3480
     ctggagattc tttctcgtct cgttagcaaa cagatatgga aatatccgaa actgtgggtt      3540
     gggtttttga aatgcacaca gacaacacag cctcaatcat ataaggtctt actacagctt      3600
     cctccacttc aactgggaaa cgcattgact aaaatcccgg ccttaagagc tccgctaacc      3660
     gcacatgcca gccagccaga gattcaatct tcacttccaa ggtctacatt ggctgttctt      3720
     ggacttgtcc ctgattctca aggaacacaa acaagccaag tgcaagcgaa tgagacacaa      3780
     acgagtcagg aacagcagca acagcaagca agcgagccac agcaaacgag ccagtctcag      3840
     caagtttctg taccattgag ccactcccaa gtagatcacc aggaacccag tcaggtagtt      3900
     gccagtcagt ctcaaagcag tcccataggg accgtccagt cagcaatgag tcagtctcag      3960
     aacagtccca tagatacggg ccggtctgaa atgagtcagt ctcagaacag tcccatagat      4020
     acgggccggt ctgaaatgag tcagtctcag aacagtccca tagatacggg ccggtctgaa      4080
     atgagtcagt ctcagaacag tcccatagat acgggaagat ctgaaatgag tgaatctcag      4140
     agcagtccta ttggtcagtc acaaagcagt cctattggta ctggccagtc tgatatgagt      4200
     caaacccctc aagtgtcgga ctcgagtgct ccagaaccaa caagccatac tcggacatca      4260
     gatcctcaag cgtcaagcca gacactacga gatgatgatg agaagataga cgacacagca      4320
     acctcagaaa acgaggtgac agaaatcgag aaatcaaaag aatcttccga agaagaagaa      4380
     gaagaagaag aagaagaaga gtga                                             4404
//

If you have problems or comments...

PBIL Back to PBIL home page