(data stored in ACNUC13479 zone)

EMBL: CP002688.PE75

CP002688.PE75        Location/Qualifiers
FT   CDS_pept        complement(join(162803..163505,163615..163718,
FT                   163809..163892,163996..164040,164121..164192,
FT                   164295..164375,164517..164612,164685..164759,
FT                   164845..164892,164996..165079,165167..165274,
FT                   165352..165414,165520..165669,165790..165888,
FT                   165970..166017,166265..166507,166582..166698,
FT                   166988..167056,167391..167936,168051..168605,
FT                   168711..168836,169035..169206,169645..169813,
FT                   169924..169969))
FT                   /codon_start=1
FT                   /gene="ESP4"
FT                   /gene_synonym="ENHANCED SILENCING PHENOTYPE 4"
FT                   /gene_synonym="T10O8.110"
FT                   /gene_synonym="T10O8_110"
FT                   /locus_tag="AT5G01400"
FT                   /product="HEAT repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01400"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR022075"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B9H2"
FT                   /protein_id="ANM68244.1"
FT                   /translation="MKFVEALILLYTPHEGIEADFNISILRGGHPVLKIGDLSIEASQK
FT                   LGLLLDQLRHPAAKSLNSSTIIVLINSLSSVAKKRPAYCGRILPVLLSLDPLSFLKGVY
FT                   AAATNLALKTVFLSCLKCTHPAAAPWKDRLTSALKEIEGGGQAAKAKDLFYKTNGSIQD
FT                   KDSVEDTKVSVEENPLCASSDVAESNLSRKRSGSEYNIDLNGDASDGKRARITPSVSEE
FT                   STDGLNGNDGVSLPRVASTSTGPSDSRGVSDSGPAQQLVGLFGTLVSQGEKAIGSLEIL
FT                   ISSISADLLTDVVMANMHNIPPNCSSYADGTDELVMNMCIVGSDAQIKYPPSFVAGVLS
FT                   LSTAFPPIAALINPHNEDEEVYSVHVDQQMFPAEDARTPPGLLATCDTSFPENEESNTV
FT                   SPQNVHYIGNRESGIPGLESSAQHDGSGALVTNVLSSTNVEAASKNQNASFSGKLLVDV
FT                   IPSMSVDKLEEFSPKAVGTVASASQFVLPKISAPVVDLSDEEKDSLQKLVFLRIVEAYK
FT                   QISMSGGSQLRFSLLAHLGVEFPSELDPWKILQEHVLSDYLNHEGHELTVRVLYRLYGE
FT                   AEAEQDFFSSTTAASAYESFLLTVAEALRDSFPPSDKSLSKLLGDSPHLPKSVLMLLES
FT                   FCCPGSGEVEKDLQHGDRVTQGLSAVWSLILMRPGIRNDCLNIALQSAVHHLEEIRMKA
FT                   IRLVANKLYSLSFITEQIEEFAKDRLFSVVSDDCDKMDLDLKSPPNKPQHSISGMSMET
FT                   PSEATSSSTSVTEAQRCLSLYFALCTKKHSLFVHVFSIYKNASDPVKQAIHLQIPILVR
FT                   TMGSSSELLKIIADPPSGSDNLLIQVLQTLTEGPTPSSELILTIRKLFDTRIKDVEILF
FT                   PILPFLPRDDVLRIFPHMVNLPMEKFQVALSRVLQGSSQSGPVLSPSEALIAIHSIDPA
FT                   RDGIPLKQVTDACNTCFAQRQTFTQQVLAGVLNQLVQQIPLPMLFMRTVLQAIGAFPAL
FT                   SDFILEILSRLVSKQIWKYPKLWVGFLKCTQTTQPQSYKVLLQLPPLQLGNALTKIPAL
FT                   RAPLTAHASQPEIQSSLPRSTLAVLGLVPDSQGTQTSQVQANETQTSQEQQQQQASEPQ
FT                   QTSQSQQVSVPLSHSQVDHQEPSQVVASQSQSSPIGTVQSAMSQSQNSPIDTGRSEMSQ
FT                   SQNSPIDTGRSEMSQSQNSPIDTGRSEMSQSQNSPIDTGRSEMSESQSSPIGQSQSSPI
FT                   GTGQSDMSQTPQVSDSSAPEPTSHTRTSDPQASSQTLRDDDEKIDDTATSENEVTEIEK
FT                   SKESSEEEEEEEEEEE"
     atgaaatttg tggaagcgct tattctcttg tatactcctc atgaaggaat tgaagcagat        60
     tttaatatat ctattctccg tgggggtcat cctgttttga aaattggaga tttgtcaatt       120
     gaggccagcc agaaattggg tttactgctt gatcagctta ggcaccctgc agcaaaatct       180
     ctaaatagct cgacgattat tgttcttatc aatagtcttt catcagttgc aaagaaacgt       240
     cctgcatact gtggacgaat tctacctgtt ctactgagct tggatcccct aagctttctc       300
     aaaggagtgt atgctgcagc aacaaatctt gccttgaaga ctgtatttct ctcctgcttg       360
     aaatgtacac atcccgctgc tgcaccgtgg aaggaccggt tgaccagtgc tcttaaagag       420
     atagaaggtg gaggtcaggc agccaaagcg aaagatctct tttacaagac taacggaagc       480
     attcaggaca aagacagtgt agaagatacc aaggtatcag tggaagagaa tcctctctgt       540
     gcaagttctg atgtagcaga aagtaactta agtaggaaaa gatctggatc agaatacaat       600
     attgatctaa atggagatgc ttccgatgga aaacgtgcaa gaataacacc ttctgtgtca       660
     gaagaatcca ctgacggatt aaatggtaat gatggggtct ctctacctcg ggttgcttct       720
     acctcgaccg gaccaagtga tagcagagga gtgagtgata gtggacctgc tcagcagcta       780
     gttggtttgt ttggaacctt ggtttctcag ggtgaaaaag caattggatc tttggagatt       840
     cttatttcaa gtatttcggc ggatttactt actgatgttg tgatggctaa tatgcataat       900
     attccaccaa attgttcttc ttatgctgat ggcaccgatg agttggtgat gaacatgtgt       960
     atagttggca gtgatgcaca aattaaatat ccaccatcat ttgtagcggg tgtcctttca      1020
     ttgtcaaccg cattcccacc aattgctgcc ctgataaatc ctcacaatga agatgaggaa      1080
     gtctattctg ttcatgtgga ccagcaaatg tttccagctg aagatgcaag aactccacct      1140
     ggcttattag ctacctgtga tacttctttt ccagaaaatg aagaaagcaa tactgtgtct      1200
     ccacaaaatg tgcattacat agggaataga gaaagtggaa tacctggact ggaatcttct      1260
     gctcaacatg atgggtcagg agcccttgtt actaatgtat tgagttctac gaatgtggag      1320
     gctgcaagca aaaatcaaaa tgcgagtttc agtggaaaac ttcttgtcga tgtaattccc      1380
     tcaatgtctg tggataagtt ggaggaattt agtccaaagg cggttggcac agttgcttcg      1440
     gcgagtcagt ttgtcttacc taagatatca gcacctgttg tcgacctttc tgatgaagag      1500
     aaagacagtt tacaaaagct ggtttttttg cgcattgttg aagcatataa gcaaatatca      1560
     atgtctggtg gctcacaact ccgcttttct cttcttgctc atttaggagt tgagtttcct      1620
     tcagagttag acccttggaa aatattacag gagcacgttc tctcggatta tttgaatcat      1680
     gagggacatg agttgactgt gcgggttctt tacaggctat acggggaggc agaagcagaa      1740
     caagatttct tctcttcaac tactgctgcg tctgcatatg aaagtttctt gctaactgtg      1800
     gctgaagcac taagagattc ttttccaccg tctgacaaat ctttaagtaa attgcttgga      1860
     gattctccac atctgccgaa atcagttctg atgttgttgg aatcgttttg ctgtcctgga      1920
     agtggtgaag ttgaaaagga tttacaacat ggagaccgtg ttactcaagg tctcagtgct      1980
     gtttggagcc tgattttaat gagacctgga atccggaatg actgcctgaa tatcgctttg      2040
     cagagtgctg ttcatcactt ggaagagatt cgcatgaaag caatccgcct ggtggcaaac      2100
     aaactctatt ctttatcatt cattacagaa cagattgagg aatttgcaaa ggataggcta      2160
     ttttctgtcg taagtgatga ttgtgataag atggatcttg atctgaaaag tccaccaaac      2220
     aaaccgcaac acagtattag tggtatgagt atggagacgc cctccgaagc aacatcatca      2280
     tcaacttcag ttactgaagc tcaacgctgc ttgtcactct attttgctct ctgtaccaag      2340
     aagcactccc tttttgttca tgtattcagc atatacaaga atgcatcaga tcccgttaag      2400
     caggctattc atcttcaaat ccctattcta gttcgtacta tgggctcatc ctctgagctt      2460
     cttaaaatta tagcagaccc accaagtggg agtgacaacc ttcttataca ggttcttcaa      2520
     accctcaccg aggggcccac tccttcttca gaattgatac ttactatacg gaagttgttt      2580
     gatacaagaa taaaggatgt agagattctt ttcccaattt tgccattcct gccaagagat      2640
     gatgttctcc gcatttttcc ccatatggtg aatcttccta tggagaaatt ccaagttgca      2700
     ctttctcgtg tgctgcaggg atcatctcaa tctggcccag tgctttctcc atctgaagct      2760
     ttaattgcta tccatagcat tgacccagca agagatggaa taccacttaa acaggtcaca      2820
     gatgcatgca atacctgttt tgcgcagagg cagacattca ctcaacaggt tttagccggt      2880
     gttctgaatc aactggtcca gcaaattcca ctgccaatgt tattcatgcg tacagtttta      2940
     caagctattg gtgcttttcc agctctgtcg gacttcatcc tggagattct ttctcgtctc      3000
     gttagcaaac agatatggaa atatccgaaa ctgtgggttg ggtttttgaa atgcacacag      3060
     acaacacagc ctcaatcata taaggtctta ctacagcttc ctccacttca actgggaaac      3120
     gcattgacta aaatcccggc cttaagagct ccgctaaccg cacatgccag ccagccagag      3180
     attcaatctt cacttccaag gtctacattg gctgttcttg gacttgtccc tgattctcaa      3240
     ggaacacaaa caagccaagt gcaagcgaat gagacacaaa cgagtcagga acagcagcaa      3300
     cagcaagcaa gcgagccaca gcaaacgagc cagtctcagc aagtttctgt accattgagc      3360
     cactcccaag tagatcacca ggaacccagt caggtagttg ccagtcagtc tcaaagcagt      3420
     cccataggga ccgtccagtc agcaatgagt cagtctcaga acagtcccat agatacgggc      3480
     cggtctgaaa tgagtcagtc tcagaacagt cccatagata cgggccggtc tgaaatgagt      3540
     cagtctcaga acagtcccat agatacgggc cggtctgaaa tgagtcagtc tcagaacagt      3600
     cccatagata cgggaagatc tgaaatgagt gaatctcaga gcagtcctat tggtcagtca      3660
     caaagcagtc ctattggtac tggccagtct gatatgagtc aaacccctca agtgtcggac      3720
     tcgagtgctc cagaaccaac aagccatact cggacatcag atcctcaagc gtcaagccag      3780
     acactacgag atgatgatga gaagatagac gacacagcaa cctcagaaaa cgaggtgaca      3840
     gaaatcgaga aatcaaaaga atcttccgaa gaagaagaag aagaagaaga agaagaagag      3900
     tga                                                                    3903
//

If you have problems or comments...

PBIL Back to PBIL home page