(data stored in ACNUC13479 zone)

EMBL: CP002688.PE77

CP002688.PE77        Location/Qualifiers
FT   CDS_pept        complement(172576..173505)
FT                   /codon_start=1
FT                   /gene="RSR4"
FT                   /gene_synonym="ARABIDOPSIS THALIANA PYRIDOXINE BIOSYNTHESIS
FT                   1.3"
FT                   /gene_synonym="ATPDX1"
FT                   /gene_synonym="ATPDX1.3"
FT                   /gene_synonym="PDX1"
FT                   /gene_synonym="PDX1.3"
FT                   /gene_synonym="PYRIDOXINE BIOSYNTHESIS 1.3"
FT                   /gene_synonym="REDUCED SUGAR RESPONSE 4"
FT                   /gene_synonym="T10O8.120"
FT                   /gene_synonym="T10O8_120"
FT                   /locus_tag="AT5G01410"
FT                   /product="Aldolase-type TIM barrel family protein"
FT                   /note="REDUCED SUGAR RESPONSE 4 (RSR4); FUNCTIONS IN:
FT                   protein homodimerization activity, protein
FT                   heterodimerization activity; INVOLVED IN: in 12 processes;
FT                   LOCATED IN: cytosol, endomembrane system, plasma membrane;
FT                   EXPRESSED IN: 26 plant structures; EXPRESSED DURING: 15
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Vitamin B6
FT                   biosynthesis protein (InterPro:IPR001852),
FT                   Ribulose-phosphate binding barrel (InterPro:IPR011060);
FT                   BEST Arabidopsis thaliana protein match is: pyridoxine
FT                   biosynthesis 1.1 (TAIR:AT2G38230.1); Has 1807 Blast hits to
FT                   1807 proteins in 277 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0;
FT                   Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01410"
FT                   /db_xref="GOA:Q8L940"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="PDB:5K2Z"
FT                   /db_xref="PDB:5K3V"
FT                   /db_xref="PDB:5LNR"
FT                   /db_xref="PDB:5LNS"
FT                   /db_xref="PDB:5LNU"
FT                   /db_xref="PDB:5LNV"
FT                   /db_xref="PDB:5LNW"
FT                   /db_xref="PDB:6HX3"
FT                   /db_xref="PDB:6HXG"
FT                   /db_xref="PDB:6HYE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8L940"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR352127.1,INSD:EH871921.1,INSD:DR352160.1,
FT                   INSD:BP655325.1,INSD:DR352152.1,INSD:DR352111.1,
FT                   INSD:DR352099.1,INSD:DR352078.1,INSD:DR352126.1,
FT                   INSD:EH893878.1,INSD:EH849943.1,INSD:DR352129.1,
FT                   INSD:BP639550.1,INSD:EH922006.1,INSD:DR352121.1,
FT                   INSD:DR352130.1,INSD:BP832517.1,INSD:DR352080.1,
FT                   INSD:AV806200.1,INSD:ES100717.1,INSD:DR352159.1,
FT                   INSD:BP861855.1,INSD:EH901794.1,INSD:EL014450.1,
FT                   INSD:AV441604.1,INSD:DR352100.1,INSD:DR352083.1,
FT                   INSD:BP611672.1,INSD:EH836524.1,INSD:BP605035.1,
FT                   INSD:BP563180.1,INSD:DR352097.1,INSD:AV819953.1,
FT                   INSD:AV799969.1,INSD:AV831641.1,INSD:DR352125.1,
FT                   INSD:DR352164.1,INSD:DR352089.1,INSD:DR352144.1,
FT                   INSD:DR352110.1,INSD:DR352098.1,INSD:DR352137.1,
FT                   INSD:DR352076.1,INSD:AV534608.1,INSD:AV518959.1,
FT                   INSD:EH971941.1,INSD:DR352163.1,INSD:BP582044.1,
FT                   INSD:DR352123.1,INSD:DR352109.1,INSD:DR352128.1,
FT                   INSD:BP777823.1,INSD:DR352145.1,INSD:DR352143.1,
FT                   INSD:BP611368.1,INSD:AV549741.1,INSD:DR246985.1,
FT                   INSD:DR352094.1,INSD:AV537351.1,INSD:EL149964.1,
FT                   INSD:EH878980.1,INSD:DR352139.1,INSD:DR352102.1,
FT                   INSD:DR352077.1,INSD:DR352136.1,INSD:AV551235.1,
FT                   INSD:DR246981.1,INSD:BP593083.1,INSD:AV519278.1,
FT                   INSD:DR352124.1,INSD:BP824791.1,INSD:DR352084.1,
FT                   INSD:AV537724.1,INSD:BP623357.1,INSD:AV518173.1,
FT                   INSD:DR352131.1,INSD:EL330598.1,INSD:DR352134.1,
FT                   INSD:BP596625.1,INSD:BP838585.1,INSD:DR352118.1,
FT                   INSD:EH876328.1,INSD:DR352147.1,INSD:EH873327.1,
FT                   INSD:BP814405.1,INSD:DR246980.1,INSD:EL269098.1,
FT                   INSD:F15457.1,INSD:AV800124.1,INSD:BP565258.1,
FT                   INSD:CF652052.1,INSD:DR352086.1,INSD:BP650338.1,
FT                   INSD:CK117561.1,INSD:BP657959.1,INSD:AV439561.2,
FT                   INSD:DR352074.1,INSD:EL149568.1,INSD:DR352085.1,
FT                   INSD:DR352171.1,INSD:BP570729.1,INSD:EL166336.1,
FT                   INSD:BP649440.1,INSD:BP595613.1,INSD:DR352156.1,
FT                   INSD:DR352106.1,INSD:EL228642.1,INSD:DR352119.1,
FT                   INSD:EH916734.1,INSD:BP585718.1,INSD:EL288508.1,
FT                   INSD:ES097500.1,INSD:DR352170.1,INSD:AV549151.1,
FT                   INSD:EG453633.1,INSD:EG453635.1,INSD:BP642883.1,
FT                   INSD:EL986677.1,INSD:DR352117.1,INSD:DR352172.1,
FT                   INSD:EL280199.1,INSD:BP588289.1,INSD:EH961795.1,
FT                   INSD:AV519115.1,INSD:DR352155.1,INSD:AV800331.1,
FT                   INSD:CK120606.1,INSD:EL131840.1,INSD:DR352161.1,
FT                   INSD:DR352148.1,INSD:EH991607.1,INSD:DR246984.1,
FT                   INSD:AV813143.1,INSD:DR352113.1,INSD:DR246979.1,
FT                   INSD:BP839043.1,INSD:DR352114.1,INSD:EL039470.1,
FT                   INSD:BP633123.1,INSD:EL303183.1,INSD:DR352116.1,
FT                   INSD:BG459232.1,INSD:BP634389.1,INSD:BP798881.1,
FT                   INSD:DR352135.1,INSD:BP644212.1,INSD:EL286442.1,
FT                   INSD:EG453594.1,INSD:DR352112.1,INSD:AV525804.1,
FT                   INSD:DR352138.1,INSD:ES037658.1,INSD:EL317491.1,
FT                   INSD:F15381.1,INSD:DR352154.1,INSD:EH888298.1,
FT                   INSD:AV830477.1,INSD:DR352088.1,INSD:AV817251.1,
FT                   INSD:EL292881.1,INSD:DR373301.1,INSD:BP615848.1,
FT                   INSD:BP621788.1,INSD:DR352108.1,INSD:DR352149.1,
FT                   INSD:AV809265.1,INSD:BP795107.1,INSD:N38597.1,
FT                   INSD:DR352115.1,INSD:DR352087.1,INSD:AV534914.1,
FT                   INSD:BP853022.1,INSD:DR352079.1,INSD:DR352092.1,
FT                   INSD:AV811905.1,INSD:DR352104.1,INSD:BP639863.1,
FT                   INSD:DR352103.1,INSD:BP856523.2,INSD:EH861138.1,
FT                   INSD:BP818588.1,INSD:DR352141.1,INSD:AV800376.1,
FT                   INSD:BP831166.1,INSD:AI997563.1,INSD:BP805266.1,
FT                   INSD:DR352090.1,INSD:BP632713.1,INSD:DR352151.1,
FT                   INSD:F15247.1,INSD:AV524884.1,INSD:DR352166.1,
FT                   INSD:EH881726.1,INSD:EL149694.1,INSD:DR352162.1,
FT                   INSD:DR352174.1,INSD:DR352132.1,INSD:DR352169.1,
FT                   INSD:DR352093.1,INSD:EL168412.1,INSD:DR352150.1,
FT                   INSD:ES012709.1,INSD:DR352167.1,INSD:DR352120.1,
FT                   INSD:EH951509.1,INSD:DR352140.1,INSD:DR352081.1,
FT                   INSD:BP561800.2,INSD:DR352095.1,INSD:T04208.1,
FT                   INSD:DR352091.1,INSD:EH952364.1,INSD:AV549902.1,
FT                   INSD:BP652418.1,INSD:DR352173.1,INSD:EL224229.1,
FT                   INSD:DR246982.1,INSD:DR377761.1,INSD:DR352096.1,
FT                   INSD:BP612159.1,INSD:EL029992.1,INSD:DR352158.1,
FT                   INSD:EL186957.1,INSD:BP628804.1,INSD:DR352133.1,
FT                   INSD:EL132789.1,INSD:DR352101.1,INSD:ES085090.1,
FT                   INSD:DR352168.1,INSD:BP859218.1,INSD:EL049731.1,
FT                   INSD:BP844811.1,INSD:BP624382.1,INSD:DR352122.1,
FT                   INSD:EL977870.1,INSD:BP817063.1,INSD:DR352107.1,
FT                   INSD:BP856743.1,INSD:DR352075.1,INSD:EH860820.1,
FT                   INSD:EG462001.1,INSD:EL112942.1,INSD:EL032099.1,
FT                   INSD:DR352142.1,INSD:DR352082.1,INSD:BP834782.1,
FT                   INSD:EG453598.1,INSD:BP817179.1,INSD:BP619656.1,
FT                   INSD:DR352073.1,INSD:DR352105.1,INSD:AV538882.1,
FT                   INSD:AV536100.1,INSD:BP591526.1,INSD:CK121366.1,
FT                   INSD:DR352153.1,INSD:EL042620.1,INSD:AV808254.1,
FT                   INSD:EL059373.1,INSD:BP858599.1,INSD:EL325357.1,
FT                   INSD:EG462002.1,INSD:BP833855.2,INSD:ES186221.1,
FT                   INSD:BP824957.1,INSD:EL277639.1,INSD:AV524794.1,
FT                   INSD:DR352165.1,INSD:EH918575.1,INSD:EH933626.1,
FT                   INSD:DR352157.1,INSD:BP625236.1,INSD:AV560993.1,
FT                   INSD:EL253219.1,INSD:AU036594.1,INSD:DR352146.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF446352.1,INSD:AF428298.1,INSD:AY972813.1,
FT                   INSD:BX830996.1,INSD:BX831741.1,INSD:BX833592.1,
FT                   INSD:AK227197.1,INSD:BX831631.1,INSD:AY097428.1,
FT                   INSD:AY088650.1"
FT                   /protein_id="AED90340.1"
FT                   /translation="MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNAE
FT                   QARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFV
FT                   EAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIR
FT                   TKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLP
FT                   VVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLV
FT                   EVSCGLGEAMVGINLNDEKVERFANRSE"
     atggaaggaa ccggcgttgt ggcggtgtac ggtaacggtg cgataacgga ggcgaagaaa        60
     tctcccttct ccgtgaaggt cggtttggct cagatgctcc gtggtggtgt tatcatggat       120
     gtcgtcaacg ccgagcaagc tcgtatcgcc gaggaggctg gtgcttgcgc cgtcatggct       180
     ttggagcgtg ttcctgctga tatccgcgct caaggaggcg tcgctcgtat gagcgatcca       240
     caaatgatta aagaaatcaa acaagccgtt acgattccgg tgatggctaa ggctaggatt       300
     ggtcatttcg ttgaagctca gatccttgaa gcaattggaa tcgattacat cgatgagagc       360
     gaggttttga ctcttgctga tgaagatcat cacatcaaca agcataattt ccggatcccg       420
     ttcgtttgcg gttgccggaa tctcggcgag gctctgagga ggatccgtga aggtgcggcg       480
     atgattagga ccaaaggtga agctggaacc ggtaacatta ttgaagctgt gaggcatgtg       540
     aggtctgtta atggtgacat tagggttttg cgaaacatgg atgatgatga ggttttcact       600
     ttcgctaaga aattagccgc tccgtacgat ctcgtgatgc agactaagca gcttggtcgt       660
     cttcctgtag tccaattcgc cgccggtgga gtggctactc cggctgatgc agctctcatg       720
     atgcagcttg gatgtgatgg tgtctttgtt ggttctggta tcttcaagag cggtgaccca       780
     gctcgtcgtg cacgtgccat tgttcaggct gtgactcatt acagtgaccc tgagatgctt       840
     gtggaggtga gctgtgggct tggagaagcc atggttggga tcaatctcaa cgatgagaag       900
     gttgagaggt tcgctaatcg ctccgagtga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page