(data stored in ACNUC13479 zone)

EMBL: CP002688.PE78

CP002688.PE78        Location/Qualifiers
FT   CDS_pept        complement(174886..176091)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.130"
FT                   /gene_synonym="T10O8_130"
FT                   /locus_tag="AT5G01420"
FT                   /product="Glutaredoxin family protein"
FT                   /note="Glutaredoxin family protein; FUNCTIONS IN: electron
FT                   carrier activity, protein disulfide oxidoreductase
FT                   activity; INVOLVED IN: cell redox homeostasis; CONTAINS
FT                   InterPro DOMAIN/s: Thioredoxin fold (InterPro:IPR012335),
FT                   Glutaredoxin (InterPro:IPR002109), Thioredoxin-like fold
FT                   (InterPro:IPR012336); BEST Arabidopsis thaliana protein
FT                   match is: Glutaredoxin family protein (TAIR:AT5G06470.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01420"
FT                   /db_xref="GOA:Q9M031"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M031"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP839789.1,INSD:BP639998.1,INSD:BP658010.1,
FT                   INSD:BP828460.1,INSD:BP839875.1,INSD:AU238836.1,
FT                   INSD:AU230083.1,INSD:EL051293.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT005349.1,INSD:AK117993.1"
FT                   /protein_id="AED90341.1"
FT                   /translation="MKSSRMKFAKKLKSIRAGEYLNQDRILQVLSAADEFLPKISNHIP
FT                   QITSAASIWRTPQKSENQIANVTELLENVRQGEEEASGNFVGDEENVRPPVNQIPRVPC
FT                   DRKESKLAVSCGSDTGIGRKSFGSGFRRPDLNSTTLFDPKLLEAFELAALCFRKIKDFS
FT                   REARVNDEDDIVFPEEEEIRKDGNSIPPVISVVEYRRKDENVVVLHKDDGNALQIVNAI
FT                   REEVIGEEDIGKDGNTLMDPLLEFEERCPPGGEESVVFYTTTLRGIRKTFDDCNMIRFL
FT                   LDSFKVKYYERDVSMHREYREELRRISAAETEVLPPVLFVKGRCIGGAQRVLGLHEQGK
FT                   FKILFEGIPITGDERCRRCDGFRFLMCDGCRGSRRIISGDGSRIQCLICNENGLIVCVG
FT                   CS"
     atgaagtcat cgagaatgaa gtttgcaaag aagttgaaat caattagagc cggagaatat        60
     ctgaatcagg atcgaattct ccaggttctt tctgctgcag atgagtttct tccaaagata       120
     tctaaccaca ttcctcagat tacatccgcc gcttctatct ggagaacccc tcaaaagtct       180
     gaaaatcaaa ttgcaaatgt aacggaactt ttggaaaacg tgagacaagg agaagaagaa       240
     gcttctggaa attttgtcgg cgacgaggag aacgtacggc ctccggtgaa tcagattccg       300
     agagttccgt gtgatcggaa agagagtaaa ctggcagttt catgcggatc tgatacagga       360
     atcggaagaa agagtttcgg atctggattt agaagacctg atttgaattc gaccacactt       420
     ttcgatccga aactgttaga agcatttgaa ttagctgcgt tatgctttag gaagattaag       480
     gatttttcca gagaagccag agtcaatgat gaagacgaca tcgtctttcc cgaggaagag       540
     gaaatcagaa aagacgggaa tagcattcct ccggtgatta gcgtcgtaga gtatagacgg       600
     aaagacgaaa atgtcgtcgt tcttcacaaa gatgatggaa atgcccttca gattgtaaat       660
     gcgatcaggg aagaagtcat cggagaagaa gacattggaa aagacggaaa tacccttatg       720
     gatccgttgt tggaattcga ggaacggtgt cctccgggag gagaggaatc cgttgttttc       780
     tacacaacga ctcttcgagg aatcagaaaa acgttcgacg attgcaacat gatccgattt       840
     ctgctggata gttttaaggt taagtactac gagagagatg tgtcgatgca tagagagtat       900
     agagaagagc tccgacgaat ctcagcggcg gaaacagagg tgttgcctcc ggttctgttc       960
     gtaaaaggaa ggtgtatcgg tggagctcag agagtgttgg gactgcacga gcaagggaag      1020
     tttaagattc tctttgaggg cattccaatc accggagatg aacgttgccg gcggtgcgat      1080
     ggttttaggt ttttgatgtg tgatggatgc agaggtagtc gccggattat ctctggtgat      1140
     ggatcaagaa ttcagtgttt gatatgtaat gagaatgggt taattgtgtg cgttggttgc      1200
     tcctaa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page