(data stored in ACNUC13479 zone)

EMBL: CP002688.PE80

CP002688.PE80        Location/Qualifiers
FT   CDS_pept        complement(join(176797..176835,177094..177175,
FT                   177258..177355,177477..177557,177657..177748,
FT                   177980..178010))
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.140"
FT                   /locus_tag="AT5G01430"
FT                   /product="Got1/Sft2-like vescicle transport protein family"
FT                   /note="Got1/Sft2-like vescicle transport protein family;
FT                   FUNCTIONS IN: molecular_function unknown; INVOLVED IN:
FT                   vesicle-mediated transport; LOCATED IN: cellular_component
FT                   unknown; CONTAINS InterPro DOMAIN/s: Vesicle transport
FT                   protein, Got1/SFT2-like (InterPro:IPR007305); BEST
FT                   Arabidopsis thaliana protein match is: Got1/Sft2-like
FT                   vescicle transport protein family (TAIR:AT3G49420.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01430"
FT                   /db_xref="GOA:Q9SCL4"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SCL4"
FT                   /protein_id="AED90343.1"
FT                   /translation="MMSFEMNDRKKIGLGLTGFGVFFSFLGIVFVFDKGLLAMGNILFI
FT                   SGVSLTIGFKSTMQFFMKRQNYKGTISFGVGFFFVIIGWPILGMMLETYGFFVLFSGFW
FT                   PTLAVFAQKIPVLGWIIQQPYIRSFFDKYRGKRVPV"
     atgatgtcct ttgaaatgaa tgaccggaaa aaaatcgggt taggcctgac aggatttggc        60
     gtattcttct cgtttttggg aatagtcttt gtctttgata agggattact tgccatggga       120
     aatattcttt tcatctcggg ggttagtcta accattggct tcaagtctac catgcagttc       180
     ttcatgaagc gtcaaaatta taagggaacc atctcttttg gcgtcggttt cttctttgtt       240
     atcatcgggt ggcctatctt gggaatgatg ttggagacct atggcttttt cgtactcttc       300
     agtggcttct ggcctacctt ggcagtcttt gctcagaaga tacccgttct cggttggatt       360
     attcagcaac catatattag atcgttcttt gacaagtacc ggggcaagcg tgtgccggtc       420
     tag                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page