(data stored in ACNUC13479 zone)

EMBL: CP002688.PE81

CP002688.PE81        Location/Qualifiers
FT   CDS_pept        join(179822..179914,179995..180098,180211..180355,
FT                   180442..180545,180713..180922,181007..181190,
FT                   181248..181283)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.150"
FT                   /gene_synonym="T10O8_150"
FT                   /locus_tag="AT5G01440"
FT                   /product="hypothetical protein"
FT                   /note="BEST Arabidopsis thaliana protein match is:
FT                   Insulinase (Peptidase family M16) family protein
FT                   (TAIR:AT1G06900.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01440"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01440.1"
FT                   /db_xref="GOA:F4K9D7"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9D7"
FT                   /protein_id="AED90344.1"
FT                   /translation="MSLREREIFPCAKRKTDVKVKNKFESNSLAKVYFRIKCEKAQEAR
FT                   QTALLNLFVSIISDSVYNKLRIEEKLGYLVECETRLIHGVGFYVCVVSSDYNPCHLVRR
FT                   IYKFMNGIRLEGLFDKMFKDFKNGVSSKLPHDSGKTKWSEIVRESCIFDFYSEEKKELS
FT                   LITKNDLIEWYKRYVRLSSPKCCSFVVSIWGCNTKNGLEKVKILRLRRKMKVKKKQGSA
FT                   SQVNSIGQEMNTSLLMLVAKKMESFYKLMRVRQTLNYAEARNYVSLKRPWIAETVVTQS
FT                   NESIERRSKR"
     atgagcttga gagaaaggga aatatttcct tgtgccaaac gtaaaacaga tgtaaaggtg        60
     aaaaataagt tcgaatctaa ctctctagca aaggtatact ttcgaatcaa gtgtgaaaaa       120
     gcccaagaag caaggcaaac tgcattgtta aatctctttg tctccattat aagtgatagc       180
     gtctataata agctaaggat cgaagaaaag cttggttact tagttgaatg tgaaactcgc       240
     ttgatacatg gagttggttt ctatgtatgc gttgtttctt cagattacaa tccttgtcat       300
     ttggtaaggc gaatctacaa gttcatgaat ggaattcgct tggaaggttt gtttgacaaa       360
     atgtttaaag atttcaaaaa tggtgtaagt tcgaagttgc cacatgatag tgggaagaca       420
     aaatggagtg agattgttcg agaaagttgc atatttgatt tctactccga agaaaagaag       480
     gagctaagct tgatcacgaa aaatgattta atagaatggt acaaacggta tgttagacta       540
     tcttcgccta agtgctgtag ttttgttgtt tcaatttggg gatgcaacac caaaaatggt       600
     ctagagaaag tgaagattct tcggttaaga aggaagatga aagtaaagaa gaagcaaggt       660
     tcagcgagtc aggtgaattc cataggtcaa gagatgaaca catcattact tatgctagtt       720
     gcaaaaaaaa tggaatcctt ttacaagcta atgagagtaa gacagacact gaactatgcc       780
     gaggcaagaa actatgtgtc attaaaaagg ccatggattg ccgagacggt ggttacacag       840
     agcaacgaat cgatcgagag aagatcgaaa aggtga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page