(data stored in ACNUC13479 zone)

EMBL: CP002688.PE82

CP002688.PE82        Location/Qualifiers
FT   CDS_pept        complement(join(182013..182151,182239..182312,
FT                   182398..182526))
FT                   /codon_start=1
FT                   /locus_tag="AT5G01445"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: mitochondrion; Has 5 Blast hits to 5 proteins in 2
FT                   species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
FT                   Plants - 5; Viruses - 0; Other Eukaryotes - 0 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01445"
FT                   /db_xref="GOA:F4K9D8"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9D8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP656584.1,INSD:EL176842.1,INSD:BP833004.1,
FT                   INSD:CD532929.1,INSD:BP812446.1,INSD:CD532933.1,
FT                   INSD:EH987864.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AK221153.1"
FT                   /protein_id="AED90345.1"
FT                   /translation="MGRIYAHHAYRASFCSQIHICVSRLQVRSYTTNPRFARRYDFEEK
FT                   LSPDVTESQEKLLSPDVSDSSTSVAKQFQSSSKMRFLHKHKAFKMKKKKKMLVKPPSPK
FT                   KNLQCFIKT"
     atgggtagaa tttatgccca tcacgcatac agagcctctt tttgctctca aattcatatc        60
     tgcgtttcca gacttcaagt gcgaagttat actacaaatc cgcgtttcgc ccgccgctat       120
     gattttgagg aaaagttgtc gcctgatgtt actgagtcac aggaaaagtt gttgtcacct       180
     gatgttagtg actcttcgac aagcgtagct aagcagtttc aatcaagttc aaagatgcga       240
     ttcctccaca agcacaaagc ttttaaaatg aagaagaaga agaagatgct cgtgaagcca       300
     ccatcaccta aaaaaaactt gcaatgcttt attaagactt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page