(data stored in ACNUC13479 zone)

EMBL: CP002688.PE84

CP002688.PE84        Location/Qualifiers
FT   CDS_pept        join(186823..187172,187270..187355,187542..187657,
FT                   187775..187885,188070..188168,188291..188413,
FT                   188695..188757,188840..188904,189004..189113,
FT                   189215..189329,189424..189489,189592..189702,
FT                   189792..189858,189961..190008)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.170"
FT                   /gene_synonym="T10O8_170"
FT                   /locus_tag="AT5G01460"
FT                   /product="LMBR1-like membrane protein"
FT                   /note="LMBR1-like membrane protein; CONTAINS InterPro
FT                   DOMAIN/s: LMBR1-like membrane protein, conserved region
FT                   (InterPro:IPR006876); BEST Arabidopsis thaliana protein
FT                   match is: LMBR1-like membrane protein (TAIR:AT3G08930.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q9M028"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M028"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP865699.1,INSD:ES115394.1,INSD:EH980055.1,
FT                   INSD:ES015089.1,INSD:W43054.1,INSD:EH805853.1,
FT                   INSD:ES079886.1,INSD:EL972956.1,INSD:EL978699.1,
FT                   INSD:BP577633.1,INSD:ES066328.1,INSD:BP777596.1,
FT                   INSD:BP580890.1,INSD:AV808958.1,INSD:ES058672.1,
FT                   INSD:AV548573.1,INSD:EL164587.1,INSD:ES021574.1,
FT                   INSD:EH989321.1,INSD:ES184047.1,INSD:AV538129.1,
FT                   INSD:EL297477.1,INSD:EL301566.1,INSD:EH906382.1,
FT                   INSD:ES059636.1,INSD:EH859368.1,INSD:ES157284.1,
FT                   INSD:EL320410.1,INSD:EL017897.1,INSD:EH850088.1,
FT                   INSD:DR362649.1,INSD:ES146401.1,INSD:AV804746.1,
FT                   INSD:EH826817.1,INSD:EL104442.1,INSD:DR269546.1,
FT                   INSD:EL222240.1,INSD:ES083719.1,INSD:EH892503.1,
FT                   INSD:BP780727.1,INSD:EL175757.1,INSD:EL170995.1,
FT                   INSD:EL134969.1,INSD:ES097719.1,INSD:AV558344.1,
FT                   INSD:AV810629.1,INSD:ES039604.1,INSD:DR383432.1,
FT                   INSD:EL249322.1,INSD:ES085915.1,INSD:BP788146.1,
FT                   INSD:EH828938.1,INSD:AI999226.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY096440.1,INSD:AY072197.1"
FT                   /protein_id="AED90347.1"
FT                   /translation="MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFV
FT                   VVFGLSIAMISILMLPADVANRHACRHSIYNGACNLTLPMKDLWLAVYIVDAVLVFFII
FT                   PFAMFFYEGDQDKALGKRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHLSSATT
FT                   TFPTSWQFSNNQPCIGNTARQCSAYTANAASEKTWSMRTTFPEYVVALATIVGSVLFTI
FT                   FGGVGIACLPLGLITAFIRRPKAVITRSQYIKEATELGKKARDLKKAADALHQEERSGA
FT                   KGRKWRKNVKAVEKELLQLEEDVNLLEEMYPQGEQAETAWAFTVLGYLAKFVLGILGLI
FT                   VSVAWIAHIIIYLLVDPPLSPFLNEVFIKLDDVWGLLGTAAFAFFCFYLLLAVIAGAMM
FT                   LGLKLVFITIHPMKWGATLMNSFLFNVGLILLCSISVIQFCATAFGYYAQATAAQEIFG
FT                   HTLQSLRGIKYLYKYNVFQIGFVVLAGLTFLYYIAFGWRRKKPSGRFQLST"
     atgggagatt tcaatctcgc tctcgtgatt gttgcgatcg tagtttgcgt cattgttttc        60
     atctccagta tctacctcct cgtcaactat cagcatccag atgatgcaaa ccaggcttat       120
     ttccccaaat tcgttgttgt ttttggttta tccattgcta tgatctctat tctcatgtta       180
     ccggcggatg tggctaaccg gcatgcttgt cgacattcga tttacaacgg cgcttgtaat       240
     ctcaccttac ctatgaagga tctttggctt gccgtttaca ttgttgacgc tgtgcttgtc       300
     ttcttcatca tccccttcgc tatgtttttc tatgaaggcg accaggacaa ggctcttggg       360
     aagaggataa agagtgcttt gatttgggtg gttactacag ctgttgtttg tgctctggtt       420
     cttggaattt tatacggagt cattgggaag gtggacttct ctgtaaggca cttgtcttct       480
     gccacgacta ctttccctac ttcatggcag ttttcaaata atcaaccttg cattggtaac       540
     actgctcgtc agtgctcagc atatacagct aatgctgcgt ctgaaaagac atggtccatg       600
     cgtactacgt ttccagaata tgttgttgct cttgctacaa tcgttgggtc agtgctcttc       660
     acgatatttg gtggtgttgg tattgcttgc ctacccttgg gccttatcac tgcattcatc       720
     aggcgaccaa aggctgttat cactcggtca cagtatataa aggaagcaac tgaactaggt       780
     aaaaaggcaa gagatctaaa gaaagcagct gatgcacttc accaggaaga acgaagtggt       840
     gctaagggaa ggaagtggag gaaaaatgtg aaagcagttg aaaaggagtt gctccaattg       900
     gaagaagatg tgaacctctt agaagagatg tatccgcaag gagagcaggc agagactgct       960
     tgggccttca ctgtcctggg atacttggcc aagtttgttc ttggaatctt aggattaatt      1020
     gtttctgtgg cttggattgc tcacatcatc atatatctac ttgttgaccc tcccctctct      1080
     ccttttctga atgaagtttt catcaaactg gatgacgtct ggggtcttct tggcacagct      1140
     gcctttgctt tcttctgttt ctatctccta cttgctgtta ttgctggggc aatgatgctt      1200
     ggtttgaagc tggtcttcat taccattcat ccaatgaaat ggggagccac tcttatgaac      1260
     tcttttctct ttaatgtcgg tctcattctc ctctgttcta tcagtgtgat tcaattctgc      1320
     gccactgcat ttggatatta tgctcaagcc accgccgctc aggagatatt tggccacact      1380
     ttgcagtccc ttcgcggtat taagtacctc tacaagtaca atgtgttcca gatcgggttt      1440
     gttgtcctcg ctggattgac ctttttatat tacattgcct ttggatggag aagaaaaaag      1500
     ccgagcggca gattccagct ctctacctaa                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page