(data stored in ACNUC13479 zone)

EMBL: CP002688.PE85

CP002688.PE85        Location/Qualifiers
FT   CDS_pept        join(190881..191010,191099..191160,191465..191598,
FT                   191756..191901,191986..192057,192129..192227,
FT                   192296..192462)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.180"
FT                   /gene_synonym="T10O8_180"
FT                   /locus_tag="AT5G01470"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01470"
FT                   /db_xref="GOA:A0A1P8BE87"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BE87"
FT                   /protein_id="ANM69916.1"
FT                   /translation="MGTHYINRWRNTASRLANNNSTSDMDIALFSPASLFAADGDSSDG
FT                   ETTETSQNFVERNHQFPGIELQIREFGFHQLNANLLWPGTFAFADWLLQHRYLIERRRC
FT                   LEIGSGTGALAIFLKKEFNLDITTSDYNDQEIEDNIVHNCIANKIIPSLPHIKHTWGDE
FT                   FPISEPDWDLIIASDILLYVKQYPNLIKSLTFLLKKYKPTNVVSPAEGKLNGADTELPR
FT                   PVFLMSWRRRIGKDDESLFFTGCEEAGLEVKHLGNRVYCIKLRESNL"
     atgggaacac attatataaa ccgttggagg aacacagcct ctcgcttagc taacaacaac        60
     tcaacgagtg acatggacat cgccctcttc tcaccggcgt cgctctttgc tgcagacggt       120
     gactcctctg atggagagac gacggagacg agccagaact tcgttgagag aaatcatcag       180
     tttcctggaa ttgaactgca aattcgggaa tttggtttcc accagctgaa tgcaaacttg       240
     ctgtggccag gtacatttgc ctttgctgat tggttactgc agcatcgata tttgatcgaa       300
     aggcggcgct gtctcgagat aggaagtggc acaggggcac tagctatatt tcttaagaaa       360
     gagtttaatc tcgacataac tacttcagat tacaatgatc aagagattga agacaatatt       420
     gttcataact gtattgcaaa caagattatc ccttctctgc ctcatatcaa gcatacatgg       480
     ggtgatgaat ttccaatttc ggaaccagat tgggatttga tcatagccag tgatatcctt       540
     ctatatgtga aacagtaccc aaacttgatt aagtctctga cttttcttct caaaaaatac       600
     aaaccaacca atgtcgttag tccagcagaa ggtaagctaa atggagcaga cacagaactg       660
     cctcgtcctg tgttcttaat gagctggaga cgaagaattg ggaaagacga tgagtctcta       720
     ttctttacgg gctgcgaaga agctggcctg gaggtgaagc atctcggaaa ccgagtttat       780
     tgtatcaagc ttagagaaag caacctctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page