(data stored in ACNUC13479 zone)

EMBL: CP002688.PE87

CP002688.PE87        Location/Qualifiers
FT   CDS_pept        join(190881..191010,191099..191160,191465..191598,
FT                   191756..191901,191986..192057,192129..192215,
FT                   192302..192462)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.180"
FT                   /gene_synonym="T10O8_180"
FT                   /locus_tag="AT5G01470"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /note="S-adenosyl-L-methionine-dependent methyltransferases
FT                   superfamily protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 12 plant
FT                   structures; EXPRESSED DURING: 7 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Methyltransferase-16, putative
FT                   (InterPro:IPR019410); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01470"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01470.3"
FT                   /db_xref="GOA:B3H734"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B3H734"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL141324.1,INSD:R65525.1,INSD:BE524948.1,
FT                   INSD:DR296895.1,INSD:EL272610.1,INSD:EL289005.1"
FT                   /protein_id="AED90350.2"
FT                   /translation="MGTHYINRWRNTASRLANNNSTSDMDIALFSPASLFAADGDSSDG
FT                   ETTETSQNFVERNHQFPGIELQIREFGFHQLNANLLWPGTFAFADWLLQHRYLIERRRC
FT                   LEIGSGTGALAIFLKKEFNLDITTSDYNDQEIEDNIVHNCIANKIIPSLPHIKHTWGDE
FT                   FPISEPDWDLIIASDILLYVKQYPNLIKSLTFLLKKYKPTNVVSPAEDTELPRPVFLMS
FT                   WRRRIGKDDESLFFTGCEEAGLEVKHLGNRVYCIKLRESNL"
     atgggaacac attatataaa ccgttggagg aacacagcct ctcgcttagc taacaacaac        60
     tcaacgagtg acatggacat cgccctcttc tcaccggcgt cgctctttgc tgcagacggt       120
     gactcctctg atggagagac gacggagacg agccagaact tcgttgagag aaatcatcag       180
     tttcctggaa ttgaactgca aattcgggaa tttggtttcc accagctgaa tgcaaacttg       240
     ctgtggccag gtacatttgc ctttgctgat tggttactgc agcatcgata tttgatcgaa       300
     aggcggcgct gtctcgagat aggaagtggc acaggggcac tagctatatt tcttaagaaa       360
     gagtttaatc tcgacataac tacttcagat tacaatgatc aagagattga agacaatatt       420
     gttcataact gtattgcaaa caagattatc ccttctctgc ctcatatcaa gcatacatgg       480
     ggtgatgaat ttccaatttc ggaaccagat tgggatttga tcatagccag tgatatcctt       540
     ctatatgtga aacagtaccc aaacttgatt aagtctctga cttttcttct caaaaaatac       600
     aaaccaacca atgtcgttag tccagcagaa gacacagaac tgcctcgtcc tgtgttctta       660
     atgagctgga gacgaagaat tgggaaagac gatgagtctc tattctttac gggctgcgaa       720
     gaagctggcc tggaggtgaa gcatctcgga aaccgagttt attgtatcaa gcttagagaa       780
     agcaacctct ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page