(data stored in ACNUC13479 zone)

EMBL: CP002688.PE89

CP002688.PE89        Location/Qualifiers
FT   CDS_pept        join(190953..191010,191099..191160,191465..191598,
FT                   191756..191901,191986..192057,192129..192227,
FT                   192296..192462)
FT                   /codon_start=1
FT                   /gene_synonym="T10O8.180"
FT                   /gene_synonym="T10O8_180"
FT                   /locus_tag="AT5G01470"
FT                   /product="S-adenosyl-L-methionine-dependent
FT                   methyltransferases superfamily protein"
FT                   /note="S-adenosyl-L-methionine-dependent methyltransferases
FT                   superfamily protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 12 plant
FT                   structures; EXPRESSED DURING: 7 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Methyltransferase-16, putative
FT                   (InterPro:IPR019410); Has 375 Blast hits to 375 proteins in
FT                   142 species: Archae - 2; Bacteria - 36; Metazoa - 120;
FT                   Fungi - 106; Plants - 76; Viruses - 0; Other Eukaryotes -
FT                   35 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01470"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01470.2"
FT                   /db_xref="GOA:A8MS01"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8MS01"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL141324.1,INSD:BE524948.1,INSD:DR296895.1,
FT                   INSD:EL272610.1,INSD:EL289005.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT014727.1,INSD:BT015510.1"
FT                   /protein_id="AED90349.1"
FT                   /translation="MDIALFSPASLFAADGDSSDGETTETSQNFVERNHQFPGIELQIR
FT                   EFGFHQLNANLLWPGTFAFADWLLQHRYLIERRRCLEIGSGTGALAIFLKKEFNLDITT
FT                   SDYNDQEIEDNIVHNCIANKIIPSLPHIKHTWGDEFPISEPDWDLIIASDILLYVKQYP
FT                   NLIKSLTFLLKKYKPTNVVSPAEGKLNGADTELPRPVFLMSWRRRIGKDDESLFFTGCE
FT                   EAGLEVKHLGNRVYCIKLRESNL"
     atggacatcg ccctcttctc accggcgtcg ctctttgctg cagacggtga ctcctctgat        60
     ggagagacga cggagacgag ccagaacttc gttgagagaa atcatcagtt tcctggaatt       120
     gaactgcaaa ttcgggaatt tggtttccac cagctgaatg caaacttgct gtggccaggt       180
     acatttgcct ttgctgattg gttactgcag catcgatatt tgatcgaaag gcggcgctgt       240
     ctcgagatag gaagtggcac aggggcacta gctatatttc ttaagaaaga gtttaatctc       300
     gacataacta cttcagatta caatgatcaa gagattgaag acaatattgt tcataactgt       360
     attgcaaaca agattatccc ttctctgcct catatcaagc atacatgggg tgatgaattt       420
     ccaatttcgg aaccagattg ggatttgatc atagccagtg atatccttct atatgtgaaa       480
     cagtacccaa acttgattaa gtctctgact tttcttctca aaaaatacaa accaaccaat       540
     gtcgttagtc cagcagaagg taagctaaat ggagcagaca cagaactgcc tcgtcctgtg       600
     ttcttaatga gctggagacg aagaattggg aaagacgatg agtctctatt ctttacgggc       660
     tgcgaagaag ctggcctgga ggtgaagcat ctcggaaacc gagtttattg tatcaagctt       720
     agagaaagca acctctga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page